StarFunc result for job id P33681

User Input

>input (288 residues)
MGHTRRQGTSPSKCPYLNFFQLLVLAGLSHFCSGVIHVTKEVKEVATLSCGHNVSVEELA
QTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFDITNNLSIVILALRPSDEGTYECVVLK
YEKDAFKREHLAEVTLSVKADFPTPSISDFEIPTSNIRRIICSTSGGFPEPHLSWLENGE
ELNAINTTVSQDPETELYAVSSKLDFNMTTNHSFMCLIKYGHLRVNQTFNWNTTKQEHFP
DNLLPSWAITLISVNGIFVICCLTYCFAPRCRERRRNERLRRESVRPV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33681	1.000	1.000	1.513E-54	288	1.000	1.000	P33681.pdb.gz	CD80_HUMAN T-lymphocyte activation antigen CD80 OS=Homo sapiens OX=9606 GN=CD80 PE=1 SV=1
2	AFDB:G3V671	0.606	0.550	1.186E-34	321	0.455	0.408	G3V671.pdb.gz	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
3	AFDB:Q00609	0.700	0.663	2.118E-32	306	0.427	0.402	Q00609.pdb.gz	CD80_MOUSE T-lymphocyte activation antigen CD80 OS=Mus musculus OX=10090 GN=Cd80 PE=1 SV=1
4	AFDB:Q9JHJ8	0.625	0.564	8.502E-19	322	0.215	0.193	Q9JHJ8.pdb.gz	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
5	AFDB:O35531	0.587	0.545	1.111E-18	313	0.215	0.198	O35531.pdb.gz	O35531_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
6	AFDB:P42081	0.554	0.495	1.451E-18	329	0.219	0.191	P42081.pdb.gz	CD86_HUMAN T-lymphocyte activation antigen CD86 OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=2
7	AFDB:D4AE25	0.529	0.526	9.939E-18	290	0.198	0.197	D4AE25.pdb.gz	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
8	AFDB:Q8VE98	0.587	0.540	1.789E-17	316	0.243	0.222	Q8VE98.pdb.gz	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
9	AFDB:Q9NZQ7	0.440	0.438	2.466E-17	290	0.184	0.183	Q9NZQ7.pdb.gz	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
10	AFDB:P42082	0.552	0.519	5.212E-17	309	0.201	0.188	P42082.pdb.gz	CD86_MOUSE T-lymphocyte activation antigen CD86 OS=Mus musculus OX=10090 GN=Cd86 PE=1 SV=1
11	PDB:4adfM	0.511	0.741	1.107E-11	191	0.146	0.220	4adfM.pdb.gz
12	PDB:3c2aL	0.297	0.384	3.401E-11	216	0.139	0.185	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
13	PDB:1q0xL	0.291	0.356	7.187E-11	212	0.122	0.165	1q0xL.pdb.gz
14	PDB:3o3uN	0.482	0.259	1.045E-10	580	0.125	0.062	3o3uN.pdb.gz	The 1.5 A crystal structure of human receptor for advanced glycation endproducts (RAGE) ectodomains reveals unique features determining ligand binding.
15	PDB:1ospL	0.305	0.372	1.365E-10	214	0.139	0.187	1ospL.pdb.gz
16	PDB:1c12A	0.267	0.346	1.519E-10	214	0.132	0.178	1c12A.pdb.gz	Insight into odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide.
17	PDB:2qhrL	0.330	0.413	1.690E-10	218	0.153	0.202	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
18	PDB:4fqqL	0.324	0.405	1.881E-10	213	0.149	0.202	4fqqL.pdb.gz
19	PDB:5nqkB	0.291	0.339	1.984E-10	242	0.125	0.149	5nqkB.pdb.gz	human 199.16 TCR in complex with Melan-A/MART-1 (26-35) peptide and HLA-A2
20	PDB:1cf8L	0.290	0.359	2.330E-10	215	0.135	0.181	1cf8L.pdb.gz	Convergence of Catalytic Antibody and Terpene Cyclase Mechanisms: Polyene Cyclization Directed by Carbocation-pi Interactions

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33681	0.0	602	288	1.000	1.000	CD80_HUMAN T-lymphocyte activation antigen CD80 OS=Homo sapiens OX=9606 GN=CD80 PE=1 SV=1
2	O35187	3.59e-76	236	321	0.385	0.346	O35187_RAT B7.1 OS=Rattus norvegicus OX=10116 GN=Cd80 PE=2 SV=1
3	G3V671	7.62e-76	236	324	0.385	0.343	G3V671_RAT Cd80 molecule OS=Rattus norvegicus OX=10116 GN=Cd80 PE=4 SV=2
4	Q00609	2.28e-71	224	306	0.438	0.412	CD80_MOUSE T-lymphocyte activation antigen CD80 OS=Mus musculus OX=10090 GN=Cd80 PE=1 SV=1
5	P42081	1.55e-12	68.9	329	0.240	0.210	CD86_HUMAN T-lymphocyte activation antigen CD86 OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=2
6	H7C4F8	2.31e-11	65.1	277	0.212	0.220	H7C4F8_HUMAN CD86 molecule (Fragment) OS=Homo sapiens OX=9606 GN=CD86 PE=1 SV=1
7	D4AE25	2.09e-09	59.3	290	0.184	0.183	D4AE25_RAT CD274 molecule OS=Rattus norvegicus OX=10116 GN=Cd274 PE=4 SV=2
8	Q8VE98	2.48e-09	59.3	316	0.170	0.155	CD276_MOUSE CD276 antigen OS=Mus musculus OX=10090 GN=Cd276 PE=1 SV=1
9	A0N0L8	5.54e-09	58.2	302	0.174	0.166	A0N0L8_HUMAN Inducible T-cell co-stimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=2 SV=1
10	O75144	5.54e-09	58.2	302	0.174	0.166	ICOSL_HUMAN ICOS ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=2
11	O35531	9.73e-09	57.8	313	0.188	0.173	O35531_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
12	K4DIA0	1.13e-08	57.8	473	0.174	0.106	K4DIA0_HUMAN Inducible T cell costimulator ligand OS=Homo sapiens OX=9606 GN=ICOSLG PE=1 SV=1
13	Q5ZPR3	2.66e-08	57.0	534	0.201	0.109	CD276_HUMAN CD276 antigen OS=Homo sapiens OX=9606 GN=CD276 PE=1 SV=1
14	Q9EP73	3.09e-08	55.8	290	0.156	0.155	PD1L1_MOUSE Programmed cell death 1 ligand 1 OS=Mus musculus OX=10090 GN=Cd274 PE=1 SV=1
15	A0A8J8XMF6	9.81e-08	54.7	297	0.177	0.172	A0A8J8XMF6_RAT CD86 molecule OS=Rattus norvegicus OX=10116 GN=Cd86 PE=1 SV=1
16	Q9NZQ7	1.79e-07	53.5	290	0.156	0.155	PD1L1_HUMAN Programmed cell death 1 ligand 1 OS=Homo sapiens OX=9606 GN=CD274 PE=1 SV=1
17	P42082	5.30e-07	52.4	309	0.160	0.149	CD86_MOUSE T-lymphocyte activation antigen CD86 OS=Mus musculus OX=10090 GN=Cd86 PE=1 SV=1
18	Q9JHJ8	5.30e-07	52.4	322	0.188	0.168	ICOSL_MOUSE ICOS ligand OS=Mus musculus OX=10090 GN=Icoslg PE=1 SV=1
19	Q868Z9	1.15e-06	52.4	2898	0.118	0.012	PPN_DROME Papilin OS=Drosophila melanogaster OX=7227 GN=Ppn PE=1 SV=2
20	Q9UIR0	1.56e-06	51.2	455	0.115	0.073	BTNL2_HUMAN Butyrophilin-like protein 2 OS=Homo sapiens OX=9606 GN=BTNL2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08205 C2-set_2	5.9e-18	76.0	CD80-like C2-set immunoglobulin domain
2	PF07679 I-set	0.0015	29.9	Immunoglobulin I-set domain
3	PF00047 ig	0.0043	28.5	Immunoglobulin domain
4	PF13895 Ig_2	1.7	20.3	Immunoglobulin domain
5	PF13927 Ig_3	0.00015	33.5	Immunoglobulin domain
6	PF07686 V-set	9.6e-06	37.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264246

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303939	0.999	Cytotoxic T-lymphocyte protein 4
2	9606.ENSP00000324890	0.999	T-cell-specific surface glycoprotein CD28
3	9606.ENSP00000011653	0.994	T-cell surface glycoprotein CD4
4	9606.ENSP00000386559	0.989	T-cell surface glycoprotein CD8 alpha chain
5	9606.ENSP00000370989	0.988	Programmed cell death 1 ligand 1
6	9606.ENSP00000412237	0.986	Interleukin-10
7	9606.ENSP00000452780	0.983	Beta-2-microglobulin
8	9606.ENSP00000264832	0.981	Intercellular adhesion molecule 1
9	9606.ENSP00000332049	0.981	T-lymphocyte activation antigen CD86
10	9606.ENSP00000454623	0.972	Integrin alpha-X
11	9606.ENSP00000380855	0.966	Programmed cell death 1 ligand 2
12	9606.ENSP00000335062	0.965	Programmed cell death protein 1
13	9606.ENSP00000349252	0.962	Integrin alpha-L
14	9606.ENSP00000441691	0.960	Integrin alpha-M
15	9606.ENSP00000379873	0.959	HLA class I histocompatibility antigen, A-3 alpha chain
16	9606.ENSP00000379350	0.957	Integrin beta-1
17	9606.ENSP00000354782	0.956	T-cell surface glycoprotein CD3 zeta chain
18	9606.ENSP00000327513	0.955	Macrophage colony-stimulating factor 1
19	9606.ENSP00000354566	0.954	T-cell surface glycoprotein CD3 epsilon chain
20	9606.ENSP00000361359	0.954	Tumor necrosis factor receptor superfamily member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.998	positive regulation of cellular process
GO:0010604	0.908	positive regulation of macromolecule metabolic process
GO:0050896	0.826	response to stimulus
GO:0042325	0.815	regulation of phosphorylation
GO:0001932	0.804	regulation of protein phosphorylation
GO:0009987	0.788	cellular process
GO:0050730	0.696	regulation of peptidyl-tyrosine phosphorylation
GO:0051716	0.662	cellular response to stimulus
GO:0031325	0.615	positive regulation of cellular metabolic process
GO:0010562	0.598	positive regulation of phosphorus metabolic process
GO:0007154	0.501	cell communication
GO:0023052	0.489	signaling
GO:0051239	0.478	regulation of multicellular organismal process
GO:0051173	0.466	positive regulation of nitrogen compound metabolic process
GO:0007165	0.459	signal transduction
GO:0051247	0.445	positive regulation of protein metabolic process
GO:0002682	0.434	regulation of immune system process
GO:0002684	0.406	positive regulation of immune system process
GO:0051240	0.379	positive regulation of multicellular organismal process
GO:0002694	0.379	regulation of leukocyte activation
GO:0031401	0.369	positive regulation of protein modification process
GO:0042327	0.367	positive regulation of phosphorylation
GO:0001934	0.352	positive regulation of protein phosphorylation
GO:0048519	0.334	negative regulation of biological process
GO:0002376	0.325	immune system process
GO:0030155	0.318	regulation of cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.979	cell surface
GO:0032991	0.951	protein-containing complex
GO:0005622	0.734	intracellular anatomical structure
GO:0043226	0.723	organelle
GO:0005737	0.709	cytoplasm
GO:0043229	0.693	intracellular organelle
GO:0043227	0.640	membrane-bounded organelle
GO:0098636	0.622	protein complex involved in cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]