StarFunc result for job id P33908

User Input

>input (653 residues)
MPVGGLLPLFSSPAGGVLGGGLGGGGGRKGSGPAALRLTEKFVLLLVFSAFITLCFGAIF
FLPDSSKLLSGVLFHSSPALQPAADHKPGPGARAEDAAEGRARRREEGAPGDPEAALEDN
LARIRENHERALREAKETLQKLPEEIQRDILLEKKKVAQDQLRDKAPFRGLPPVDFVPPI
GVESREPADAAIREKRAKIKEMMKHAWNNYKGYAWGLNELKPISKGGHSSSLFGNIKGAT
IVDALDTLFIMEMKHEFEEAKSWVEENLDFNVNAEISVFEVNIRFVGGLLSAYYLSGEEI
FRKKAVELGVKLLPAFHTPSGIPWALLNMKSGIGRNWPWASGGSSILAEFGTLHLEFMHL
SHLSGNPIFAEKVMNIRTVLNKLEKPQGLYPNYLNPSSGQWGQHHVSVGGLGDSFYEYLL
KAWLMSDKTDLEAKKMYFDAVQAIETHLIRKSSSGLTYIAEWKGGLLEHKMGHLTCFAGG
MFALGADAAPEGMAQHYLELGAEIARTCHESYNRTFMKLGPEAFRFDGGVEAIATRQNEK
YYILRPEVMETYMYMWRLTHDPKYRKWAWEAVEALENHCRVNGGYSGLRDVYLLHESYDD
VQQSFFLAETLKYLYLIFSDDDLLPLEHWIFNSEAHLLPILPKDKKEVEIREE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P45700	0.852	0.850	9.768E-97	655	0.908	0.905	P45700.pdb.gz	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
2	AFDB:O60476	0.733	0.747	1.314E-70	641	0.602	0.613	O60476.pdb.gz	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
3	AFDB:Q9NR34	0.697	0.722	1.671E-62	630	0.508	0.527	Q9NR34.pdb.gz	MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
4	AFDB:P53624	0.713	0.699	4.149E-56	667	0.461	0.451	P53624.pdb.gz	MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
5	AFDB:O18498	0.696	0.679	1.223E-53	670	0.450	0.439	O18498.pdb.gz	MA1A1_SPOFR Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
6	AFDB:Q9C512	0.682	0.792	1.499E-43	560	0.322	0.375	Q9C512.pdb.gz	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
7	AFDB:A2AJ15	0.676	0.671	4.724E-42	658	0.322	0.319	A2AJ15.pdb.gz	MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
8	AFDB:Q9UKM7	0.670	0.628	2.994E-41	699	0.315	0.295	Q9UKM7.pdb.gz	MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
9	AFDB:Q9VAP8	0.682	0.651	5.529E-40	685	0.303	0.289	Q9VAP8.pdb.gz	Q9VAP8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ib PE=1 SV=1
10	AFDB:A0A1D8PD38	0.671	0.712	5.698E-39	615	0.273	0.289	A0A1D8PD38.pdb.gz	A0A1D8PD38_CANAL alpha-1,2-Mannosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNS1 PE=3 SV=1
11	PDB:1dl2A	0.651	0.829	4.175E-35	510	0.262	0.335	1dl2A.pdb.gz
12	PDB:1fp3A	0.344	0.519	4.293E-5	402	0.061	0.100	1fp3A.pdb.gz
13	PDB:2rgkA	0.373	0.552	4.507E-5	409	0.078	0.125	2rgkA.pdb.gz
14	PDB:3qxqA	0.289	0.501	7.550E-4	338	0.063	0.121	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
15	PDB:6wq1A	0.357	0.537	8.735E-4	396	0.096	0.159	6wq1A.pdb.gz	LanCLs add glutathione to dehydroamino acids generated at phosphorylated sites in the proteome.
16	PDB:3aniA	0.299	0.469	9.170E-4	378	0.058	0.101	3aniA.pdb.gz
17	PDB:6trhC	0.282	0.439	1.725E-3	385	0.069	0.117	6trhC.pdb.gz	Structural analysis of the reducing-end xylose-releasing exo-oligoxylanase Rex8A from Paenibacillus barcinonensis BP-23 deciphers its molecular specificity.
18	PDB:3qryB	0.303	0.416	2.424E-3	426	0.081	0.124	3qryB.pdb.gz	Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
19	PDB:5hssA	0.294	0.472	2.804E-3	366	0.070	0.126	5hssA.pdb.gz	X-ray structure of linalool dehydratase/isomerase from Castellaniella defragrans reveals enzymatic alkene synthesis.
20	PDB:3t33A	0.371	0.540	5.024E-3	407	0.083	0.133	3t33A.pdb.gz	Crystal Structure of Arabidopsis GCR2 Identifies a Novel Clade of Lantibiotic Cyclase-Like Proteins

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O18498	0.0	546	670	0.461	0.449	MA1A1_SPOFR Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
2	O60476	0.0	785	641	0.594	0.605	MA1A2_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Homo sapiens OX=9606 GN=MAN1A2 PE=1 SV=1
3	P33908	0.0	1337	653	1.000	1.000	MA1A1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens OX=9606 GN=MAN1A1 PE=1 SV=3
4	P39098	0.0	783	641	0.596	0.607	MA1A2_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB OS=Mus musculus OX=10090 GN=Man1a2 PE=1 SV=1
5	P45700	0.0	1172	655	0.902	0.899	MA1A1_MOUSE Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Mus musculus OX=10090 GN=Man1a1 PE=1 SV=1
6	P53624	0.0	579	667	0.412	0.403	MA1A1_DROME Mannosyl-oligosaccharide alpha-1,2-mannosidase IA OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ia PE=2 SV=2
7	Q9NR34	0.0	647	630	0.518	0.537	MA1C1_HUMAN Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC OS=Homo sapiens OX=9606 GN=MAN1C1 PE=1 SV=1
8	Q9C512	1.14e-125	385	560	0.308	0.359	MNS1_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS1 OS=Arabidopsis thaliana OX=3702 GN=MNS1 PE=1 SV=1
9	Q8H116	1.94e-123	379	572	0.332	0.379	MNS2_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS2 OS=Arabidopsis thaliana OX=3702 GN=MNS2 PE=1 SV=1
10	A2AJ15	4.10e-104	332	658	0.329	0.327	MA1B1_MOUSE Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Mus musculus OX=10090 GN=Man1b1 PE=1 SV=1
11	Q9UKM7	8.65e-101	325	699	0.306	0.286	MA1B1_HUMAN Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN1B1 PE=1 SV=2
12	Q9VAP8	8.11e-95	308	685	0.263	0.251	Q9VAP8_DROME alpha-1,2-Mannosidase OS=Drosophila melanogaster OX=7227 GN=alpha-Man-Ib PE=1 SV=1
13	Q93Y37	8.37e-86	283	624	0.280	0.293	MNS3_ARATH Mannosyl-oligosaccharide 1,2-alpha-mannosidase MNS3 OS=Arabidopsis thaliana OX=3702 GN=MNS3 PE=1 SV=1
14	A0A1D8PD38	3.51e-84	278	615	0.263	0.280	A0A1D8PD38_CANAL alpha-1,2-Mannosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNS1 PE=3 SV=1
15	A2RBC3	1.27e-78	263	603	0.260	0.282	A2RBC3_ASPNC alpha-1,2-Mannosidase OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An18g06220 PE=3 SV=1
16	P32906	4.74e-77	258	549	0.268	0.319	MNS1_YEAST Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MNS1 PE=1 SV=1
17	Q9P7C3	6.26e-73	246	521	0.250	0.313	MNS1_SCHPO Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC2E1P5.01c PE=1 SV=2
18	Q2UMC2	1.03e-68	239	711	0.254	0.233	Q2UMC2_ASPOR alpha-1,2-Mannosidase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=AO090003000057 PE=3 SV=1
19	Q9SXC9	7.43e-62	218	574	0.234	0.267	MNS5_ARATH Alpha-mannosidase I MNS5 OS=Arabidopsis thaliana OX=3702 GN=MNS5 PE=1 SV=1
20	Q8BJT9	3.93e-53	194	577	0.242	0.274	EDEM2_MOUSE ER degradation-enhancing alpha-mannosidase-like protein 2 OS=Mus musculus OX=10090 GN=Edem2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17050 AIM5	1.4e+02	14.6	Altered inheritance of mitochondria 5
2	PF10410 DnaB_bind	94	14.8	DnaB-helicase binding domain of primase
3	PF01532 Glyco_hydro_47	1.1e-142	487.9	Glycosyl hydrolase family 47

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357453

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261483	0.978	Alpha-mannosidase 2
2	9606.ENSP00000404718	0.969	Alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
3	9606.ENSP00000452948	0.959	Alpha-mannosidase 2x
4	9606.ENSP00000360645	0.916	Endoplasmic reticulum mannosyl-oligosaccharide 1,2-alpha-mannosidase
5	9606.ENSP00000348959	0.906	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
6	9606.ENSP00000363452	0.905	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IC
7	9606.ENSP00000417354	0.903	Golgi integral membrane protein 4
8	9606.ENSP00000306496	0.900	Ras-related protein Rab-33B
9	9606.ENSP00000315775	0.730	Conserved oligomeric Golgi complex subunit 4
10	9606.ENSP00000355629	0.698	Conserved oligomeric Golgi complex subunit 2
11	9606.ENSP00000401831	0.694	Acyl-CoA synthetase family member 2, mitochondrial
12	9606.ENSP00000182527	0.690	Translocating chain-associated membrane protein 2
13	9606.ENSP00000381293	0.686	Vesicle-fusing ATPase
14	9606.ENSP00000266041	0.678	Inter-alpha-trypsin inhibitor heavy chain H4
15	9606.ENSP00000233616	0.674	Mannosyl-oligosaccharide glucosidase
16	9606.ENSP00000353401	0.674	Homeobox protein cut-like 1
17	9606.ENSP00000324628	0.672	Gamma-soluble NSF attachment protein
18	9606.ENSP00000225724	0.668	Golgi SNAP receptor complex member 1
19	9606.ENSP00000305442	0.662	Conserved oligomeric Golgi complex subunit 7
20	9606.ENSP00000263354	0.650	Alpha-soluble NSF attachment protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004571	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0046872	0.997	metal ion binding
GO:0005509	0.993	calcium ion binding
GO:0005515	0.787	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006517	0.982	protein deglycosylation
GO:0006491	0.941	N-glycan processing
GO:0036503	0.908	ERAD pathway
GO:0030433	0.896	ubiquitin-dependent ERAD pathway
GO:0051179	0.755	localization
GO:0051234	0.747	establishment of localization
GO:0006810	0.712	transport
GO:0051641	0.551	cellular localization
GO:0033036	0.498	macromolecule localization
GO:0071702	0.472	organic substance transport
GO:0045184	0.437	establishment of protein localization
GO:0006605	0.395	protein targeting
GO:0070085	0.301	glycosylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0000139	1.000	Golgi membrane
GO:0005576	0.981	extracellular region
GO:1903561	0.940	extracellular vesicle
GO:0070062	0.924	extracellular exosome
GO:0005783	0.714	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.113	1.000	mannosyl-oligosaccharide 1,2-alpha-mannosidase.

[back to server]