StarFunc result for job id P33981

User Input

>input (857 residues)
MESEDLSGRELTIDSIMNKVRDIKNKFKNEDLTDELSLNKISADTTDNSGTVNQIMMMAN
NPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAELK
AIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLEML
EIALRNLNLQKKQLLSEEEKKNLSASTVLTAQESFSGSLGHLQNRNNSCDSRGQTTKARF
LYGENMPPQDAEIGYRNSLRQTNKTKQSCPFGRVPVNLLNSPDCDVKTDDSVVPCFMKRQ
TSRSECRDLVVPGSKPSGNDSCELRNLKSVQNSHFKEPLVSDEKSSELIITDSITLKNKT
ESSLLAKLEETKEYQEPEVPESNQKQWQSKRKSECINQNPAASSNHWQIPELARKVNTEQ
KHTTFEQPVFSVSKQSPPISTSKWFDPKSICKTPSSNTLDDYMSCFRTPVVKNDFPPACQ
LSTPYGQPACFQQQQHQILATPLQNLQVLASSSANECISVKGRIYSILKQIGSGGSSKVF
QVLNEKKQIYAIKYVNLEEADNQTLDSYRNEIAYLNKLQQHSDKIIRLYDYEITDQYIYM
VMECGNIDLNSWLKKKKSIDPWERKSYWKNMLEAVHTIHQHGIVHSDLKPANFLIVDGML
KLIDFGIANQMQPDTTSVVKDSQVGTVNYMPPEAIKDMSSSRENGKSKSKISPKSDVWSL
GCILYYMTYGKTPFQQIINQISKLHAIIDPNHEIEFPDIPEKDLQDVLKCCLKRDPKQRI
SIPELLAHPYVQIQTHPVNQMAKGTTEEMKYVLGQLVGLNSPNSILKAAKTLYEHYSGGE
SHNSSSSKTFEKKRGKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P33981	1.000	1.000	0.000	857	1.000	1.000	P33981.pdb.gz	TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2
2	AFDB:P35761	0.451	0.452	4.745E-83	856	0.736	0.737	P35761.pdb.gz	TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus OX=10090 GN=Ttk PE=1 SV=1
3	AFDB:Q84VX4	0.314	0.345	4.324E-26	777	0.216	0.238	Q84VX4.pdb.gz	MPS1_ARATH Serine/threonine-protein kinase MPS1 OS=Arabidopsis thaliana OX=3702 GN=MPS1 PE=2 SV=1
4	AFDB:Q9CAD5	0.271	0.263	2.898E-16	883	0.159	0.154	Q9CAD5.pdb.gz	YODA_ARATH Mitogen-activated protein kinase kinase kinase YODA OS=Arabidopsis thaliana OX=3702 GN=YDA PE=1 SV=1
5	PDB:4gcjA	0.264	0.684	1.911E-15	304	0.092	0.260	4gcjA.pdb.gz	Development of highly potent and selective diaminothiazole inhibitors of cyclin-dependent kinases.
6	PDB:1unlA	0.255	0.711	1.215E-14	292	0.096	0.281	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors
7	PDB:5u6yA	0.255	0.458	2.722E-14	459	0.085	0.159	5u6yA.pdb.gz
8	PDB:4ek6A	0.250	0.708	3.450E-14	279	0.090	0.276	4ek6A.pdb.gz	Crystal structure of the cdk2 in complex with aminopyrazole inhibitor
9	PDB:4eomC	0.261	0.764	3.793E-14	276	0.095	0.293	4eomC.pdb.gz	An integrated chemical biology approach provides insight into Cdk2 functional redundancy and inhibitor sensitivity.
10	PDB:4krcA	0.260	0.701	3.978E-14	297	0.092	0.266	4krcA.pdb.gz	New Structural Insights into Phosphorylation-free Mechanism for Full Cyclin-dependent Kinase (CDK)-Cyclin Activity and Substrate Recognition.
11	PDB:4rgjA	0.254	0.443	4.171E-14	463	0.089	0.164	4rgjA.pdb.gz
12	PDB:4yc3A	0.260	0.703	6.392E-14	295	0.086	0.251	4yc3A.pdb.gz
13	PDB:4c0tA	0.264	0.721	1.242E-13	291	0.079	0.234	4c0tA.pdb.gz
14	AFDB:Q32MK0	0.280	0.292	1.518E-13	819	0.158	0.165	Q32MK0.pdb.gz	MYLK3_HUMAN Myosin light chain kinase 3 OS=Homo sapiens OX=9606 GN=MYLK3 PE=1 SV=3
15	PDB:4rerA	0.274	0.499	1.651E-13	459	0.103	0.192	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
16	AFDB:O14098	0.271	0.383	2.219E-13	593	0.141	0.204	O14098.pdb.gz	CTK1_SCHPO CTD kinase subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsk1 PE=1 SV=1
17	AFDB:Q9LFA2	0.267	0.245	5.212E-13	934	0.165	0.151	Q9LFA2.pdb.gz	KIPK1_ARATH Serine/threonine-protein kinase KIPK1 OS=Arabidopsis thaliana OX=3702 GN=KIPK1 PE=1 SV=1
18	AFDB:M9PGC5	0.268	0.100	1.480E-12	2462	0.137	0.048	M9PGC5.pdb.gz	WNK_DROME Serine/threonine-protein kinase Wnk OS=Drosophila melanogaster OX=7227 GN=Wnk PE=1 SV=2
19	AFDB:Q01389	0.265	0.158	1.789E-12	1478	0.158	0.091	Q01389.pdb.gz	BCK1_YEAST Serine/threonine-protein kinase BCK1/SLK1/SSP31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BCK1 PE=1 SV=1
20	AFDB:Q9VP22	0.261	0.196	1.876E-12	1157	0.144	0.106	Q9VP22.pdb.gz	CDK12_DROME Cyclin-dependent kinase 12 OS=Drosophila melanogaster OX=7227 GN=Cdk12 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P33981	0.0	1779	857	1.000	1.000	TTK_HUMAN Dual specificity protein kinase TTK OS=Homo sapiens OX=9606 GN=TTK PE=1 SV=2
2	P35761	0.0	1260	856	0.740	0.741	TTK_MOUSE Dual specificity protein kinase TTK OS=Mus musculus OX=10090 GN=Ttk PE=1 SV=1
3	Q8AYG3	3.19e-162	500	982	0.310	0.271	TTK_DANRE Dual specificity protein kinase Ttk OS=Danio rerio OX=7955 GN=ttk PE=1 SV=2
4	O94235	4.53e-72	252	678	0.155	0.196	MPH1L_SCHPO Serine/threonine-protein kinase mph1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mph1 PE=2 SV=1
5	Q84VX4	8.93e-69	245	777	0.159	0.175	MPS1_ARATH Serine/threonine-protein kinase MPS1 OS=Arabidopsis thaliana OX=3702 GN=MPS1 PE=2 SV=1
6	Q54UL8	9.90e-68	245	983	0.155	0.135	MPS1_DICDI Probable serine/threonine-protein kinase mps1 OS=Dictyostelium discoideum OX=44689 GN=mps1 PE=3 SV=1
7	Q9VEH1	4.62e-64	229	630	0.154	0.210	Q9VEH1_DROME LD04521p OS=Drosophila melanogaster OX=7227 GN=Mps1 PE=2 SV=1
8	Q5B953	3.35e-61	224	828	0.151	0.156	Q5B953_EMENI Checkpoint protein kinase, putative (AFU_orthologue AFUA_3G08100) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02927 PE=4 SV=1
9	A0A0B4KG66	1.35e-58	214	672	0.139	0.177	A0A0B4KG66_DROME Monopolar spindle 1, isoform B OS=Drosophila melanogaster OX=7227 GN=Mps1 PE=4 SV=1
10	P54199	2.28e-57	213	764	0.132	0.148	MPS1_YEAST Serine/threonine-protein kinase MPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPS1 PE=1 SV=2
11	A0A1D8PTW7	3.46e-51	193	690	0.153	0.190	A0A1D8PTW7_CANAL Serine/threonine/tyrosine protein kinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MPS1 PE=4 SV=1
12	Q6PHR2	3.54e-29	124	472	0.095	0.172	ULK3_HUMAN Serine/threonine-protein kinase ULK3 OS=Homo sapiens OX=9606 GN=ULK3 PE=1 SV=2
13	Q9VHF6	1.25e-28	123	520	0.093	0.154	Q9VHF6_DROME Serine/threonine-protein kinase ULK3 OS=Drosophila melanogaster OX=7227 GN=Aduk PE=4 SV=1
14	Q95YH7	1.16e-26	120	1571	0.102	0.055	Q95YH7_DROME Mekk1a OS=Drosophila melanogaster OX=7227 GN=Mekk1 PE=2 SV=1
15	Q8MSQ4	1.17e-26	120	1571	0.102	0.055	Q8MSQ4_DROME Mekk1, isoform B OS=Drosophila melanogaster OX=7227 GN=Mekk1 PE=2 SV=1
16	Q9VE37	1.60e-26	119	1478	0.102	0.059	Q9VE37_DROME Mekk1, isoform D OS=Drosophila melanogaster OX=7227 GN=Mekk1 PE=4 SV=3
17	Q95YH6	1.88e-26	119	1497	0.097	0.055	Q95YH6_DROME Mekk1b OS=Drosophila melanogaster OX=7227 GN=Mekk1 PE=2 SV=1
18	Q8T2I8	4.73e-26	117	1167	0.109	0.080	SEPA_DICDI Serine/threonine-protein kinase sepA OS=Dictyostelium discoideum OX=44689 GN=sepA PE=2 SV=1
19	A8WFS2	4.91e-26	117	1231	0.097	0.067	A8WFS2_DANRE Serine/threonine kinase 36 (fused homolog, Drosophila) OS=Danio rerio OX=7955 GN=fu PE=2 SV=1
20	Q9Y6R4	6.47e-26	117	1608	0.091	0.049	M3K4_HUMAN Mitogen-activated protein kinase kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP3K4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	0.93	20.1	ABC1 atypical kinase-like domain
2	PF01636 APH	0.43	22.0	Phosphotransferase enzyme family
3	PF19250 DUF5898	1.6e+02	13.7	Family of unknown function (DUF5898)
4	PF13095 FTA2	0.08	24.2	Kinetochore Sim4 complex subunit FTA2
5	PF06293 Kdo	0.45	21.4	Lipopolysaccharide kinase (Kdo/WaaP) family
6	PF14531 Kinase-like	0.0005	31.1	Kinase-like
7	PF08311 Mad3_BUB1_I	41	15.5	Mad3/BUB1 homology region 1
8	PF17014 Mad3_BUB1_I_2	27	16.3	Putative Mad3/BUB1 like region 1 protein
9	PF00069 Pkinase	1.3e-65	233.0	Protein kinase domain
10	PF17667 Pkinase_fungal	15	15.8	Fungal protein kinase
11	PF07714 PK_Tyr_Ser-Thr	1.1e-29	115.1	Protein tyrosine and serine/threonine kinase
12	PF01163 RIO1	1.9	19.6	RIO1 family
13	PF19974 TCAD9	43	14.6	Ternary complex associated domain 9
14	PF13428 TPR_14	6.2e+02	12.7	Tetratricopeptide repeat
15	PF00091 Tubulin	1.6e+02	13.9	Tubulin/FtsZ family, GTPase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358813

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296509	0.999	Mitotic spindle assembly checkpoint protein MAD2A
2	9606.ENSP00000302530	0.999	Mitotic checkpoint serine/threonine-protein kinase BUB1
3	9606.ENSP00000261597	0.998	Kinetochore protein NDC80 homolog
4	9606.ENSP00000361540	0.997	Cell division cycle protein 20 homolog
5	9606.ENSP00000260731	0.995	Kinesin-like protein KIF11
6	9606.ENSP00000287598	0.995	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta
7	9606.ENSP00000251496	0.993	Condensin complex subunit 3
8	9606.ENSP00000265148	0.993	Centromere-associated protein E
9	9606.ENSP00000356379	0.993	Abnormal spindle-like microcephaly-associated protein
10	9606.ENSP00000378699	0.993	Cyclin-dependent kinase 1
11	9606.ENSP00000247191	0.991	Disks large-associated protein 5
12	9606.ENSP00000271452	0.991	Kinetochore protein Nuf2
13	9606.ENSP00000274026	0.989	Cyclin-A2
14	9606.ENSP00000385334	0.989	Mitotic spindle assembly checkpoint protein MAD1
15	9606.ENSP00000362146	0.988	Borealin
16	9606.ENSP00000257934	0.982	Separin
17	9606.ENSP00000377793	0.980	Protein regulator of cytokinesis 1
18	9606.ENSP00000288207	0.978	G2/mitotic-specific cyclin-B2
19	9606.ENSP00000411532	0.976	DNA topoisomerase 2-alpha
20	9606.ENSP00000428489	0.974	Lymphokine-activated killer T-cell-originated protein kinase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004713	1.000	protein tyrosine kinase activity
GO:0004674	1.000	protein serine/threonine kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0010965	0.981	regulation of mitotic sister chromatid separation
GO:0051784	0.981	negative regulation of nuclear division
GO:1905819	0.981	negative regulation of chromosome separation
GO:1902100	0.981	negative regulation of metaphase/anaphase transition of cell cycle
GO:0033048	0.981	negative regulation of mitotic sister chromatid segregation
GO:0007346	0.979	regulation of mitotic cell cycle
GO:1903047	0.975	mitotic cell cycle process
GO:0045841	0.962	negative regulation of mitotic metaphase/anaphase transition
GO:0000075	0.957	cell cycle checkpoint signaling
GO:0071840	0.954	cellular component organization or biogenesis
GO:0016043	0.944	cellular component organization
GO:0007094	0.944	mitotic spindle assembly checkpoint signaling
GO:0006996	0.907	organelle organization
GO:0019222	0.814	regulation of metabolic process
GO:0048518	0.809	positive regulation of biological process
GO:0060255	0.720	regulation of macromolecule metabolic process
GO:0051171	0.712	regulation of nitrogen compound metabolic process
GO:0080090	0.710	regulation of primary metabolic process
GO:0048522	0.675	positive regulation of cellular process
GO:0031323	0.637	regulation of cellular metabolic process
GO:0071704	0.622	organic substance metabolic process
GO:0044238	0.622	primary metabolic process
GO:0006807	0.615	nitrogen compound metabolic process
GO:0043170	0.586	macromolecule metabolic process
GO:0044237	0.566	cellular metabolic process
GO:0051246	0.445	regulation of protein metabolic process
GO:0031399	0.419	regulation of protein modification process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0015630	0.992	microtubule cytoskeleton
GO:0005737	0.991	cytoplasm
GO:0016020	0.984	membrane
GO:0005829	0.948	cytosol
GO:0032991	0.886	protein-containing complex
GO:0070013	0.849	intracellular organelle lumen
GO:0043231	0.848	intracellular membrane-bounded organelle
GO:0005819	0.848	spindle
GO:0005634	0.770	nucleus
GO:0005694	0.755	chromosome
GO:0031981	0.740	nuclear lumen
GO:0098687	0.564	chromosomal region
GO:0099080	0.418	supramolecular complex
GO:0000776	0.378	kinetochore
GO:0005654	0.327	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10596	1.000	ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein]

[back to server]