StarFunc result for job id P33993

User Input

>input (719 residues)
MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDP
ELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVR
SPQNQYPAELMRRFELYFQGPSSNKPRVIREVRADSVGKLVTVRGIVTRVSEVKPKMVVA
TYTCDQCGAETYQPIQSPTFMPLIMCPSQECQTNRSGGRLYLQTRGSRFIKFQEMKMQEH
SDQVPVGNIPRSITVLVEGENTRIAQPGDHVSVTGIFLPILRTGFRQVVQGLLSETYLEA
HRIVKMNKSEDDESGAGELTREELRQIAEEDFYEKLAASIAPEIYGHEDVKKALLLLLVG
GVDQSPRGMKIRGNINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVLR
DSVSGELTLEGGALVLADQGVCCIDEFDKMAEADRTAIHEVMEQQTISIAKAGILTTLNA
RCSILAAANPAYGRYNPRRSLEQNIQLPAALLSRFDLLWLIQDRPDRDNDLRLAQHITYV
HQHSRQPPSQFEPLDMKLMRRYIAMCREKQPMVPESLADYITAAYVEMRREAWASKDATY
TSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADV
IFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDEYEELNVWQVNASRTRITFV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z4A5	0.882	0.882	0.000	719	1.000	1.000	A0A0S2Z4A5.pdb.gz	A0A0S2Z4A5_HUMAN DNA replication licensing factor MCM7 (Fragment) OS=Homo sapiens OX=9606 GN=MCM7 PE=2 SV=1
2	AFDB:Q7ZVL6	0.914	0.912	0.000	721	0.807	0.804	Q7ZVL6.pdb.gz	Q7ZVL6_DANRE DNA replication licensing factor MCM7 OS=Danio rerio OX=7955 GN=sr:nyz175 PE=1 SV=1
3	AFDB:Q7ZXB1	0.975	0.974	0.000	720	0.834	0.833	Q7ZXB1.pdb.gz	MCM7B_XENLA DNA replication licensing factor mcm7-B OS=Xenopus laevis OX=8355 GN=mcm7-b PE=2 SV=1
4	AFDB:Q9XYU0	0.828	0.827	0.000	720	0.675	0.674	Q9XYU0.pdb.gz	MCM7_DROME DNA replication licensing factor Mcm7 OS=Drosophila melanogaster OX=7227 GN=Mcm7 PE=1 SV=1
5	PDB:6xtx7	0.755	0.897	2.618E-100	598	0.830	0.998	6xtx7.pdb.gz	CryoEM structures of human CMG-ATP gamma S-DNA and CMG-AND-1 complexes.
6	AFDB:O16297	0.870	0.858	4.956E-95	730	0.501	0.493	O16297.pdb.gz	O16297_CAEEL DNA replication licensing factor MCM7 OS=Caenorhabditis elegans OX=6239 GN=mcm-7 PE=1 SV=1
7	AFDB:P43299	0.897	0.900	4.313E-94	716	0.497	0.499	P43299.pdb.gz	MCM7_ARATH DNA replication licensing factor MCM7 OS=Arabidopsis thaliana OX=3702 GN=MCM7 PE=1 SV=2
8	PDB:7plo7	0.711	0.829	1.169E-93	607	0.843	0.998	7plo7.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
9	AFDB:O75001	0.916	0.868	1.545E-93	760	0.501	0.474	O75001.pdb.gz	MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcm7 PE=1 SV=1
10	AFDB:P38132	0.878	0.753	3.357E-91	845	0.497	0.422	P38132.pdb.gz	MCM7_YEAST DNA replication licensing factor MCM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCM7 PE=1 SV=4
11	AFDB:A0A0R4IF39	0.767	0.901	4.070E-86	608	0.612	0.724	A0A0R4IF39.pdb.gz
12	AFDB:Q381H2	0.844	0.831	5.831E-83	731	0.406	0.399	Q381H2.pdb.gz	Q381H2_TRYB2 DNA helicase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7810 PE=3 SV=1
13	PDB:7v3u7	0.783	0.804	4.052E-78	699	0.473	0.486	7v3u7.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.
14	PDB:6rax7	0.771	0.869	4.786E-78	632	0.618	0.703	6rax7.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
15	PDB:6raz7	0.756	0.895	2.669E-73	601	0.602	0.720	6raz7.pdb.gz	Molecular Basis for ATP-Hydrolysis-Driven DNA Translocation by the CMG Helicase of the Eukaryotic Replisome.
16	PDB:6skl7	0.713	0.797	3.150E-71	635	0.459	0.520	6skl7.pdb.gz	Cryo-EM Structure of the Fork Protection Complex Bound to CMG at a Replication Fork.
17	PDB:5v8f7	0.770	0.765	1.038E-69	725	0.485	0.481	5v8f7.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
18	PDB:6wgg7	0.633	0.699	6.296E-68	641	0.456	0.512	6wgg7.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
19	PDB:5xf87	0.624	0.706	9.009E-61	622	0.455	0.526	5xf87.pdb.gz
20	PDB:7v3u6	0.745	0.825	8.287E-60	646	0.310	0.345	7v3u6.pdb.gz	Structural Insight into the MCM double hexamer activation by Dbf4-Cdc7 kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z4A5	0.0	1484	719	1.000	1.000	A0A0S2Z4A5_HUMAN DNA replication licensing factor MCM7 (Fragment) OS=Homo sapiens OX=9606 GN=MCM7 PE=2 SV=1
2	A0A8I5ZTF3	0.0	636	389	0.416	0.769	A0A8I5ZTF3_RAT DNA replication licensing factor MCM7 OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=1 SV=1
3	F7F0X7	0.0	1379	717	0.932	0.934	F7F0X7_RAT DNA replication licensing factor MCM7 OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=1 SV=1
4	O16297	0.0	717	730	0.503	0.496	O16297_CAEEL DNA replication licensing factor MCM7 OS=Caenorhabditis elegans OX=6239 GN=mcm-7 PE=1 SV=1
5	O75001	0.0	661	760	0.502	0.475	MCM7_SCHPO DNA replication licensing factor mcm7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mcm7 PE=1 SV=1
6	P33993	0.0	1484	719	1.000	1.000	MCM7_HUMAN DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4
7	P38132	0.0	625	845	0.492	0.419	MCM7_YEAST DNA replication licensing factor MCM7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCM7 PE=1 SV=4
8	P43299	0.0	681	716	0.509	0.511	MCM7_ARATH DNA replication licensing factor MCM7 OS=Arabidopsis thaliana OX=3702 GN=MCM7 PE=1 SV=2
9	Q1PS21	0.0	1396	719	0.943	0.943	Q1PS21_RAT DNA replication licensing factor MCM7 OS=Rattus norvegicus OX=10116 GN=Mcm7 PE=2 SV=1
10	Q61881	0.0	1379	719	0.928	0.928	MCM7_MOUSE DNA replication licensing factor MCM7 OS=Mus musculus OX=10090 GN=Mcm7 PE=1 SV=1
11	Q7ZVL6	0.0	1211	721	0.808	0.806	Q7ZVL6_DANRE DNA replication licensing factor MCM7 OS=Danio rerio OX=7955 GN=sr:nyz175 PE=1 SV=1
12	Q7ZXB1	0.0	1245	720	0.834	0.833	MCM7B_XENLA DNA replication licensing factor mcm7-B OS=Xenopus laevis OX=8355 GN=mcm7-b PE=2 SV=1
13	Q91876	0.0	1250	720	0.837	0.836	MCM7A_XENLA DNA replication licensing factor mcm7-A OS=Xenopus laevis OX=8355 GN=mcm7-a PE=1 SV=2
14	Q9XYU0	0.0	990	720	0.675	0.674	MCM7_DROME DNA replication licensing factor Mcm7 OS=Drosophila melanogaster OX=7227 GN=Mcm7 PE=1 SV=1
15	Q381H2	1.37e-165	496	731	0.406	0.399	Q381H2_TRYB2 DNA helicase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7810 PE=3 SV=1
16	Q9U9L0	1.37e-165	496	731	0.406	0.399	Q9U9L0_9TRYP DNA helicase OS=Trypanosoma brucei OX=5691 GN=CDC47 PE=3 SV=1
17	Q0WVF5	8.83e-117	373	847	0.313	0.266	MCM4_ARATH DNA replication licensing factor MCM4 OS=Arabidopsis thaliana OX=3702 GN=MCM4 PE=1 SV=1
18	P53091	1.68e-113	368	1017	0.341	0.241	MCM6_YEAST DNA replication licensing factor MCM6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MCM6 PE=1 SV=2
19	F4KAB8	1.82e-110	355	831	0.291	0.252	MCM6_ARATH DNA replication licensing factor MCM6 OS=Arabidopsis thaliana OX=3702 GN=MCM6 PE=1 SV=1
20	Q95XQ8	2.49e-110	355	823	0.284	0.248	MCM4_CAEEL DNA replication licensing factor mcm-4 OS=Caenorhabditis elegans OX=6239 GN=mcm-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07726 AAA_3	1.2e+02	14.0	ATPase family associated with various cellular activities (AAA)
2	PF07728 AAA_5	0.0023	29.4	AAA domain (dynein-related subfamily)
3	PF17863 AAA_lid_2	6e+02	11.7	AAA lid domain
4	PF00493 MCM	2.4e-98	339.3	MCM P-loop domain
5	PF09739 MCM_bind	65	13.4	Mini-chromosome maintenance replisome factor
6	PF17855 MCM_lid	1.7e-18	78.1	MCM AAA-lid domain
7	PF14551 MCM_N	1.8e-17	75.2	MCM N-terminal domain
8	PF17207 MCM_OB	7.6e-34	127.7	MCM OB domain
9	PF01078 Mg_chelatase	0.00012	33.1	Magnesium chelatase, subunit ChlI
10	PF13335 Mg_chelatase_C	4.2e+02	13.0	Magnesium chelatase, subunit ChlI C-terminal
11	PF00158 Sigma54_activat	5.1e+02	11.8	Sigma-54 interaction domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307288

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000209728	0.999	Cell division control protein 6 homolog
2	9606.ENSP00000216122	0.999	DNA replication licensing factor MCM5
3	9606.ENSP00000234296	0.999	Origin recognition complex subunit 2
4	9606.ENSP00000253462	0.999	DNA replication complex GINS protein PSF2
5	9606.ENSP00000257789	0.999	Origin recognition complex subunit 3
6	9606.ENSP00000262105	0.999	DNA replication licensing factor MCM4
7	9606.ENSP00000262460	0.999	DNA replication complex GINS protein PSF1
8	9606.ENSP00000264156	0.999	DNA replication licensing factor MCM6
9	9606.ENSP00000265056	0.999	DNA replication licensing factor MCM2
10	9606.ENSP00000276533	0.999	DNA replication complex GINS protein SLD5
11	9606.ENSP00000297431	0.999	Origin recognition complex subunit 5
12	9606.ENSP00000301019	0.999	DNA replication factor Cdt1
13	9606.ENSP00000353098	0.999	Mini-chromosome maintenance complex-binding protein
14	9606.ENSP00000353793	0.999	WD repeat and HMG-box DNA-binding protein 1
15	9606.ENSP00000360623	0.999	Origin recognition complex subunit 1
16	9606.ENSP00000405726	0.999	Cell division control protein 45 homolog
17	9606.ENSP00000418268	0.999	Protein MCM10 homolog
18	9606.ENSP00000441953	0.999	Origin recognition complex subunit 4
19	9606.ENSP00000480987	0.999	DNA replication licensing factor MCM3
20	9606.ENSP00000219097	0.998	Origin recognition complex subunit 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008094	0.999	ATP-dependent activity, acting on DNA
GO:0003677	0.997	DNA binding
GO:0003678	0.977	DNA helicase activity
GO:0003682	0.888	chromatin binding
GO:0003697	0.874	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.997	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0044260	0.989	cellular macromolecule metabolic process
GO:0090304	0.988	nucleic acid metabolic process
GO:0050794	0.986	regulation of cellular process
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0080090	0.977	regulation of primary metabolic process
GO:0006259	0.976	DNA metabolic process
GO:0060255	0.973	regulation of macromolecule metabolic process
GO:0050896	0.963	response to stimulus
GO:0006260	0.957	DNA replication
GO:0051716	0.950	cellular response to stimulus
GO:0031323	0.937	regulation of cellular metabolic process
GO:0019219	0.891	regulation of nucleobase-containing compound metabolic process
GO:0051276	0.809	chromosome organization
GO:0006261	0.766	DNA-templated DNA replication
GO:0032392	0.646	DNA geometric change
GO:0032508	0.616	DNA duplex unwinding
GO:0008283	0.604	cell population proliferation
GO:0009410	0.603	response to xenobiotic stimulus
GO:0070887	0.516	cellular response to chemical stimulus
GO:0006268	0.398	DNA unwinding involved in DNA replication
GO:0009719	0.383	response to endogenous stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0005829	0.994	cytosol
GO:0032991	0.982	protein-containing complex
GO:0043232	0.982	intracellular non-membrane-bounded organelle
GO:0005694	0.913	chromosome
GO:0140513	0.890	nuclear protein-containing complex
GO:0042555	0.497	MCM complex
GO:0000228	0.490	nuclear chromosome
GO:0032993	0.483	protein-DNA complex
GO:0031261	0.374	DNA replication preinitiation complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]