StarFunc result for job id P34820

User Input

>input (402 residues)
MTALPGPLWLLGLALCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRP
RAPPAASRLPASAPLFMLDLYHAMAGDDDEDGAPAERRLGRADLVMSFVNMVERDRALGH
QEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLF
FLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETEDGHSVDPGLAGLLGQRA
PRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVHGSHGRQV
CRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMMPD
AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P34820	1.000	1.000	6.260E-78	402	1.000	1.000	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
2	AFDB:P34821	0.899	0.905	2.570E-66	399	0.853	0.860	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
3	AFDB:P55105	0.864	0.870	1.087E-59	399	0.744	0.749	P55105.pdb.gz	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
4	AFDB:A8K571	0.801	0.749	1.438E-48	431	0.527	0.492	A8K571.pdb.gz	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
5	AFDB:F1P4H2	0.837	0.778	3.596E-48	434	0.535	0.495	F1P4H2.pdb.gz
6	AFDB:F1NUT2	0.809	0.704	4.462E-48	465	0.517	0.447	F1NUT2.pdb.gz
7	AFDB:A0A0R4ILD5	0.808	0.731	1.542E-47	446	0.532	0.480	A0A0R4ILD5.pdb.gz
8	AFDB:P22004	0.772	0.611	3.438E-44	513	0.522	0.409	P22004.pdb.gz	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
9	AFDB:Q9PTF9	0.756	0.707	1.396E-43	432	0.463	0.431	Q9PTF9.pdb.gz	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
10	AFDB:D4A7P9	0.395	0.517	3.263E-37	302	0.413	0.550	D4A7P9.pdb.gz	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
11	PDB:5hlyA	0.260	0.338	8.026E-16	299	0.226	0.304	5hlyA.pdb.gz
12	PDB:5ntuA	0.272	0.348	8.026E-16	308	0.194	0.253	5ntuA.pdb.gz
13	PDB:3rjrC	0.273	0.314	1.068E-14	343	0.221	0.259	3rjrC.pdb.gz
14	PDB:5vqfB	0.275	0.334	3.893E-14	320	0.211	0.266	5vqfB.pdb.gz
15	PDB:5nxsA	0.252	0.336	1.084E-13	290	0.194	0.269	5nxsA.pdb.gz
16	PDB:6umxA	0.311	0.420	1.762E-13	279	0.194	0.280	6umxA.pdb.gz
17	PDB:5ffoG	0.303	0.390	1.442E-12	297	0.209	0.283	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.254	0.320	8.097E-12	308	0.189	0.247	7y1rB.pdb.gz
19	PDB:5nxsB	0.246	0.376	7.107E-10	251	0.179	0.287	5nxsB.pdb.gz
20	PDB:6q2sA	0.159	0.527	1.726E-4	98	0.065	0.265	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34820	0.0	824	402	1.000	1.000	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
2	P34821	0.0	645	399	0.811	0.817	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
3	P55105	0.0	593	399	0.741	0.747	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
4	Q7Z5Y6	0.0	810	402	0.983	0.983	BMP8A_HUMAN Bone morphogenetic protein 8A OS=Homo sapiens OX=9606 GN=BMP8A PE=2 SV=2
5	P49003	3.73e-144	419	452	0.535	0.476	BMP5_MOUSE Bone morphogenetic protein 5 OS=Mus musculus OX=10090 GN=Bmp5 PE=1 SV=1
6	D4A7P9	1.87e-143	417	454	0.532	0.471	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
7	P22003	4.62e-143	416	454	0.530	0.469	BMP5_HUMAN Bone morphogenetic protein 5 OS=Homo sapiens OX=9606 GN=BMP5 PE=1 SV=1
8	G3V6W8	1.39e-140	409	430	0.530	0.495	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
9	P23359	1.39e-140	409	430	0.530	0.495	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2
10	Q7T288	3.57e-140	409	446	0.517	0.466	Q7T288_DANRE Bone morphogenetic protein 5 OS=Danio rerio OX=7955 GN=bmp5l PE=2 SV=1
11	A8K571	7.60e-140	407	431	0.530	0.494	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
12	P18075	7.60e-140	407	431	0.530	0.494	BMP7_HUMAN Bone morphogenetic protein 7 OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
13	Q9I8T6	3.15e-136	397	398	0.502	0.508	Q9I8T6_CHICK Bone morphogenetic protein 7 (Fragment) OS=Gallus gallus OX=9031 GN=BMP7 PE=2 SV=1
14	P20722	1.26e-123	369	510	0.520	0.410	BMP6_MOUSE Bone morphogenetic protein 6 OS=Mus musculus OX=10090 GN=Bmp6 PE=1 SV=2
15	Q04906	2.24e-122	365	506	0.510	0.405	BMP6_RAT Bone morphogenetic protein 6 OS=Rattus norvegicus OX=10116 GN=Bmp6 PE=2 SV=2
16	Q9PTF9	3.43e-122	362	432	0.485	0.451	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
17	P22004	3.85e-122	365	513	0.510	0.400	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
18	Q9R228	4.79e-111	329	306	0.393	0.516	Q9R228_RAT Bone morphogenetic protein 7 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
19	P27091	2.72e-63	211	455	0.343	0.303	60A_DROME Protein 60A OS=Drosophila melanogaster OX=7227 GN=gbb PE=1 SV=1
20	A0A8I6A920	7.28e-56	189	364	0.199	0.220	A0A8I6A920_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.3e-58	210.1	TGF-beta propeptide
2	PF00019 TGF_beta	1.2e-34	130.6	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361915

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263640	0.901	Activin receptor type-1
2	9606.ENSP00000401907	0.899	Bone morphogenetic protein receptor type-1B
3	9606.ENSP00000361107	0.894	Bone morphogenetic protein receptor type-1A
4	9606.ENSP00000363708	0.888	Bone morphogenetic protein receptor type-2
5	9606.ENSP00000241416	0.880	Activin receptor type-2A
6	9606.ENSP00000340361	0.879	Activin receptor type-2B
7	9606.ENSP00000361914	0.810	Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial
8	9606.ENSP00000327440	0.800	Bone morphogenetic protein 8A
9	9606.ENSP00000204604	0.771	Chordin
10	9606.ENSP00000478319	0.736	Gremlin-1
11	9606.ENSP00000328181	0.717	Noggin
12	9606.ENSP00000257863	0.679	Anti-Muellerian hormone type-2 receptor
13	9606.ENSP00000318650	0.665	Gremlin-2
14	9606.ENSP00000305714	0.651	Bone morphogenetic protein 1
15	9606.ENSP00000458832	0.645	Arachidonate 15-lipoxygenase
16	9606.ENSP00000289749	0.628	Neuroblastoma suppressor of tumorigenicity 1
17	9606.ENSP00000196371	0.608	Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial
18	9606.ENSP00000262999	0.603	Mitochondrial brown fat uncoupling protein 1
19	9606.ENSP00000270722	0.580	PR domain zinc finger protein 16
20	9606.ENSP00000276594	0.567	PR domain zinc finger protein 14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.999	receptor ligand activity
GO:0005125	0.991	cytokine activity
GO:0042802	0.647	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0032501	0.982	multicellular organismal process
GO:0032502	0.977	developmental process
GO:0050896	0.971	response to stimulus
GO:0010646	0.940	regulation of cell communication
GO:0023051	0.939	regulation of signaling
GO:0048856	0.935	anatomical structure development
GO:0007275	0.924	multicellular organism development
GO:0048519	0.911	negative regulation of biological process
GO:0070848	0.868	response to growth factor
GO:0048731	0.845	system development
GO:0048518	0.837	positive regulation of biological process
GO:0048522	0.806	positive regulation of cellular process
GO:0065008	0.789	regulation of biological quality
GO:0051716	0.768	cellular response to stimulus
GO:0007154	0.749	cell communication
GO:0019222	0.719	regulation of metabolic process
GO:0010817	0.689	regulation of hormone levels
GO:0060255	0.681	regulation of macromolecule metabolic process
GO:0048523	0.678	negative regulation of cellular process
GO:0007167	0.661	enzyme-linked receptor protein signaling pathway
GO:0007178	0.641	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0046883	0.639	regulation of hormone secretion
GO:0080090	0.628	regulation of primary metabolic process
GO:0002021	0.587	response to dietary excess
GO:0031323	0.585	regulation of cellular metabolic process
GO:0051171	0.561	regulation of nitrogen compound metabolic process
GO:0001501	0.554	skeletal system development
GO:0008152	0.538	metabolic process
GO:0071495	0.535	cellular response to endogenous stimulus
GO:0071363	0.490	cellular response to growth factor stimulus
GO:0048583	0.440	regulation of response to stimulus
GO:0009966	0.421	regulation of signal transduction
GO:0009893	0.417	positive regulation of metabolic process
GO:0023057	0.416	negative regulation of signaling
GO:0010648	0.416	negative regulation of cell communication
GO:0010468	0.415	regulation of gene expression
GO:0044237	0.407	cellular metabolic process
GO:0010604	0.407	positive regulation of macromolecule metabolic process
GO:0051173	0.399	positive regulation of nitrogen compound metabolic process
GO:0090092	0.394	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0050793	0.384	regulation of developmental process
GO:0071704	0.380	organic substance metabolic process
GO:0051239	0.369	regulation of multicellular organismal process
GO:0071772	0.368	response to BMP
GO:0009889	0.365	regulation of biosynthetic process
GO:0071773	0.363	cellular response to BMP stimulus
GO:0031326	0.363	regulation of cellular biosynthetic process
GO:0010556	0.359	regulation of macromolecule biosynthetic process
GO:0000003	0.354	reproduction
GO:0031325	0.353	positive regulation of cellular metabolic process
GO:0019219	0.351	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.341	regulation of RNA metabolic process
GO:0023056	0.326	positive regulation of signaling
GO:0010647	0.326	positive regulation of cell communication
GO:0048513	0.322	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0071944	0.947	cell periphery
GO:0043226	0.791	organelle
GO:0005622	0.786	intracellular anatomical structure
GO:0043231	0.759	intracellular membrane-bounded organelle
GO:0005615	0.688	extracellular space
GO:0005737	0.626	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]