StarFunc result for job id P34925

User Input

>input (607 residues)
MRGAARLGRPGRSCLPGARGLRAPPPPPLLLLLALLPLLPAPGAAAAPAPRPPELQSASA
GPSVSLYLSEDEVRRLIGLDAELYYVRNDLISHYALSFSLLVPSETNFLHFTWHAKSKVE
YKLGFQVDNVLAMDMPQVNISVQGEVPRTLSVFRVELSCTGKVDSEVMILMQLNLTVNSS
KNFTVLNFKRRKMCYKKLEEVKTSALDKNTSRTIYDPVHAAPTTSTRVFYISVGVCCAVI
FLVAIILAVLHLHSMKRIELDDSISASSSSQGLSQPSTQTTQYLRADTPNNATPITSYPT
LRIEKNDLRSVTLLEAKGKVKDIAISRERITLKDVLQEGTFGRIFHGILIDEKDPNKEKQ
AFVKTVKDQASEIQVTMMLTESCKLRGLHHRNLLPITHVCIEEGEKPMVILPYMNWGNLK
LFLRQCKLVEANNPQAISQQDLVHMAIQIACGMSYLARREVIHKDLAARNCVIDDTLQVK
ITDNALSRDLFPMDYHCLGDNENRPVRWMALESLVNNEFSSASDVWAFGVTLWELMTLGQ
TPYVDIDPFEMAAYLKDGYRIAQPINCPDELFAVMACCWALDPEERPKFQQLVQCLTEFH
AALGAYV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P34925	1.000	1.000	0.000	607	1.000	1.000	P34925.pdb.gz	RYK_HUMAN Tyrosine-protein kinase RYK OS=Homo sapiens OX=9606 GN=RYK PE=1 SV=3
2	AFDB:Q6GLP3	0.510	0.517	5.248E-92	599	0.811	0.821	Q6GLP3.pdb.gz	Q6GLP3_XENLA MGC84433 protein OS=Xenopus laevis OX=8355 GN=ryk.L PE=2 SV=1
3	AFDB:E7FAI5	0.531	0.511	2.187E-89	632	0.763	0.733	E7FAI5.pdb.gz	E7FAI5_DANRE Receptor-like tyrosine kinase OS=Danio rerio OX=7955 GN=wu:fb37b12 PE=4 SV=1
4	AFDB:A2RRV7	0.509	0.511	5.026E-89	604	0.748	0.752	A2RRV7.pdb.gz	A2RRV7_DANRE Receptor-like tyrosine kinase OS=Danio rerio OX=7955 GN=zgc:158381 PE=1 SV=1
5	AFDB:Q9V422	0.496	0.515	1.227E-56	584	0.349	0.363	Q9V422.pdb.gz	RYK2_DROME Tyrosine-protein kinase Dnt OS=Drosophila melanogaster OX=7227 GN=dnt PE=2 SV=2
6	AFDB:Q27324	0.459	0.457	1.192E-54	610	0.351	0.349	Q27324.pdb.gz	RYK1_DROME Tyrosine-protein kinase Drl OS=Drosophila melanogaster OX=7227 GN=drl PE=2 SV=1
7	AFDB:Q7JQT0	0.485	0.456	2.550E-49	648	0.313	0.293	Q7JQT0.pdb.gz	Q7JQT0_DROME Derailed 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Drl-2 PE=1 SV=1
8	AFDB:G5EGT9	0.491	0.509	3.051E-47	583	0.290	0.302	G5EGT9.pdb.gz	RYK_CAEEL Inactive tyrosine-protein kinase RYK OS=Caenorhabditis elegans OX=6239 GN=lin-18 PE=1 SV=1
9	AFDB:F8W2F8	0.439	0.199	4.526E-31	1376	0.217	0.096	F8W2F8.pdb.gz
10	AFDB:P57097	0.431	0.268	1.749E-30	994	0.226	0.138	P57097.pdb.gz	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
11	PDB:2h8hA	0.385	0.514	2.309E-20	445	0.143	0.196	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
12	PDB:4fl2A	0.394	0.428	9.403E-20	555	0.133	0.146	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
13	PDB:4k2rA	0.386	0.424	2.244E-18	551	0.130	0.143	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
14	PDB:1k9aB	0.392	0.531	6.349E-18	441	0.130	0.179	1k9aB.pdb.gz
15	PDB:6s73A	0.371	0.791	3.383E-14	269	0.089	0.201	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
16	PDB:6lk5A	0.361	0.780	3.335E-13	265	0.084	0.192	6lk5A.pdb.gz
17	PDB:4btfA	0.361	0.517	3.700E-13	413	0.089	0.131	4btfA.pdb.gz
18	PDB:7mfdA	0.345	0.488	1.507E-12	410	0.122	0.180	7mfdA.pdb.gz	Structural insights into the BRAF monomer-to-dimer transition mediated by RAS binding.
19	PDB:3eqdA	0.361	0.651	1.672E-12	315	0.091	0.175	3eqdA.pdb.gz	Crystal Structures of MEK1 Binary and Ternary Complexes with Nucleotides and Inhibitors.
20	PDB:1unlA	0.348	0.686	1.761E-12	292	0.081	0.168	1unlA.pdb.gz	Mechanism of Cdk5/P25 Binding by Cdk Inhibitors

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2RRV7	0.0	938	604	0.740	0.743	A2RRV7_DANRE Receptor-like tyrosine kinase OS=Danio rerio OX=7955 GN=zgc:158381 PE=1 SV=1
2	E7FAI5	0.0	925	632	0.740	0.710	E7FAI5_DANRE Receptor-like tyrosine kinase OS=Danio rerio OX=7955 GN=wu:fb37b12 PE=4 SV=1
3	P34925	0.0	1261	607	1.000	1.000	RYK_HUMAN Tyrosine-protein kinase RYK OS=Homo sapiens OX=9606 GN=RYK PE=1 SV=3
4	Q01887	0.0	1082	594	0.878	0.897	RYK_MOUSE Tyrosine-protein kinase RYK OS=Mus musculus OX=10090 GN=Ryk PE=1 SV=2
5	Q4V865	0.0	988	598	0.817	0.829	Q4V865_XENLA MGC114645 protein OS=Xenopus laevis OX=8355 GN=ryk.S PE=2 SV=1
6	Q6BC88	0.0	1080	594	0.876	0.896	Q6BC88_RAT Protein kinase-related protein OS=Rattus norvegicus OX=10116 GN=Ryk PE=2 SV=1
7	Q6GLP3	0.0	986	599	0.824	0.835	Q6GLP3_XENLA MGC84433 protein OS=Xenopus laevis OX=8355 GN=ryk.L PE=2 SV=1
8	Q9V422	3.06e-116	360	584	0.348	0.361	RYK2_DROME Tyrosine-protein kinase Dnt OS=Drosophila melanogaster OX=7227 GN=dnt PE=2 SV=2
9	Q27324	1.01e-85	281	610	0.227	0.226	RYK1_DROME Tyrosine-protein kinase Drl OS=Drosophila melanogaster OX=7227 GN=drl PE=2 SV=1
10	G5EGT9	3.89e-84	276	583	0.297	0.309	RYK_CAEEL Inactive tyrosine-protein kinase RYK OS=Caenorhabditis elegans OX=6239 GN=lin-18 PE=1 SV=1
11	Q7JQT0	3.05e-76	257	648	0.232	0.218	Q7JQT0_DROME Derailed 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Drl-2 PE=1 SV=1
12	Q60805	6.15e-62	223	994	0.227	0.139	MERTK_MOUSE Tyrosine-protein kinase Mer OS=Mus musculus OX=10090 GN=Mertk PE=1 SV=1
13	Q62190	7.80e-62	224	1378	0.198	0.087	RON_MOUSE Macrophage-stimulating protein receptor OS=Mus musculus OX=10090 GN=Mst1r PE=1 SV=3
14	F1QLR7	1.67e-61	223	1382	0.180	0.079	F1QLR7_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=c-met PE=4 SV=1
15	Q04912	4.52e-61	222	1400	0.213	0.092	RON_HUMAN Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R PE=1 SV=3
16	Q64GK4	8.72e-61	221	1382	0.180	0.079	Q64GK4_DANRE Hepatocyte growth factor receptor OS=Danio rerio OX=7955 GN=cmet PE=2 SV=1
17	Q12866	9.19e-61	220	999	0.188	0.114	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
18	P57097	3.81e-60	218	994	0.188	0.115	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
19	P16056	4.66e-60	219	1379	0.176	0.078	MET_MOUSE Hepatocyte growth factor receptor OS=Mus musculus OX=10090 GN=Met PE=1 SV=1
20	P08581	5.40e-60	219	1390	0.173	0.076	MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens OX=9606 GN=MET PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00069 Pkinase	2.6e-23	94.3	Protein kinase domain
2	PF07714 PK_Tyr_Ser-Thr	2.8e-77	271.1	Protein tyrosine and serine/threonine kinase
3	PF02019 WIF	1.1e-40	149.8	WIF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478721

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.999	Protein Wnt-5a
2	9606.ENSP00000293549	0.991	Proto-oncogene Wnt-1
3	9606.ENSP00000284523	0.984	Protein Wnt-3a
4	9606.ENSP00000357040	0.984	Vang-like protein 2
5	9606.ENSP00000363826	0.981	Frizzled-8
6	9606.ENSP00000380379	0.969	Protein Wnt-5b
7	9606.ENSP00000225512	0.951	Proto-oncogene Wnt-3
8	9606.ENSP00000265441	0.919	Protein Wnt-2
9	9606.ENSP00000323901	0.910	Frizzled-2
10	9606.ENSP00000354607	0.909	Frizzled-5
11	9606.ENSP00000434034	0.896	Frizzled-4
12	9606.ENSP00000286201	0.879	Frizzled-7
13	9606.ENSP00000345785	0.876	Frizzled-9
14	9606.ENSP00000287934	0.873	Frizzled-1
15	9606.ENSP00000358698	0.869	Protein Wnt-2b
16	9606.ENSP00000222462	0.864	Protein Wnt-16
17	9606.ENSP00000351605	0.860	Frizzled-6
18	9606.ENSP00000437489	0.858	Frizzled-3
19	9606.ENSP00000229030	0.852	Frizzled-10
20	9606.ENSP00000344456	0.852	Catenin beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	0.998	Wnt-protein binding
GO:0042813	0.998	Wnt receptor activity
GO:0004672	0.921	protein kinase activity
GO:0005102	0.854	signaling receptor binding
GO:0015026	0.837	coreceptor activity
GO:0001664	0.756	G protein-coupled receptor binding
GO:0005109	0.748	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007399	0.997	nervous system development
GO:0007165	0.996	signal transduction
GO:0198738	0.990	cell-cell signaling by wnt
GO:0030182	0.988	neuron differentiation
GO:0071542	0.984	dopaminergic neuron differentiation
GO:0000902	0.983	cell morphogenesis
GO:0032990	0.983	cell part morphogenesis
GO:0048666	0.983	neuron development
GO:0120036	0.982	plasma membrane bounded cell projection organization
GO:0030901	0.981	midbrain development
GO:0007166	0.975	cell surface receptor signaling pathway
GO:0016055	0.969	Wnt signaling pathway
GO:0048667	0.924	cell morphogenesis involved in neuron differentiation
GO:0048812	0.922	neuron projection morphogenesis
GO:0061564	0.869	axon development
GO:0048518	0.791	positive regulation of biological process
GO:0007409	0.769	axonogenesis
GO:0048519	0.744	negative regulation of biological process
GO:0048523	0.704	negative regulation of cellular process
GO:0048522	0.704	positive regulation of cellular process
GO:0048583	0.450	regulation of response to stimulus
GO:0023051	0.433	regulation of signaling
GO:0010646	0.433	regulation of cell communication
GO:0009966	0.420	regulation of signal transduction
GO:0019222	0.419	regulation of metabolic process
GO:0050793	0.414	regulation of developmental process
GO:0060255	0.396	regulation of macromolecule metabolic process
GO:0048584	0.335	positive regulation of response to stimulus
GO:0051239	0.321	regulation of multicellular organismal process
GO:0051128	0.319	regulation of cellular component organization
GO:0031323	0.314	regulation of cellular metabolic process
GO:0080090	0.313	regulation of primary metabolic process
GO:0051171	0.308	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.968	intracellular anatomical structure
GO:0043226	0.945	organelle
GO:0043227	0.921	membrane-bounded organelle
GO:0043229	0.905	intracellular organelle
GO:0005737	0.859	cytoplasm
GO:0043231	0.785	intracellular membrane-bounded organelle
GO:0005634	0.529	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.921	Phosphotransferases with an alcohol group as acceptor.

[back to server]