StarFunc result for job id P34931

User Input

>input (641 residues)
MATAKGIAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRKFNDPVVQADMKLWPFQVINEGGKPKVLVSYKGENKAFYPEE
ISSMVLTKLKETAEAFLGHPVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTA
AAIAYGLDKGGQGERHVLIFDLGGGTFDVSILTIDDGIFEVKATAGDTHLGGEDFDNRLV
SHFVEEFKRKHKKDISQNKRAVRRLRTACERAKRTLSSSTQANLEIDSLYEGIDFYTSIT
RARFEELCADLFRGTLEPVEKALRDAKMDKAKIHDIVLVGGSTRIPKVQRLLQDYFNGRD
LNKSINPDEAVAYGAAVQAAILMGDKSEKVQDLLLLDVAPLSLGLETAGGVMTALIKRNS
TIPTKQTQIFTTYSDNQPGVLIQVYEGERAMTKDNNLLGRFDLTGIPPAPRGVPQIEVTF
DIDANGILNVTATDKSTGKVNKITITNDKGRLSKEEIERMVLDAEKYKAEDEVQREKIAA
KNALESYAFNMKSVVSDEGLKGKISESDKNKILDKCNELLSWLEVNQLAEKDEFDHKRKE
LEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08108	0.950	0.936	0.000	651	0.819	0.806	P08108.pdb.gz	HSP70_ONCMY Heat shock cognate 70 kDa protein OS=Oncorhynchus mykiss OX=8022 GN=hsc71 PE=2 SV=2
2	AFDB:P16627	0.994	0.994	0.000	641	0.945	0.945	P16627.pdb.gz	HS71L_MOUSE Heat shock 70 kDa protein 1-like OS=Mus musculus OX=10090 GN=Hspa1l PE=1 SV=4
3	AFDB:P17066	0.971	0.968	0.000	643	0.797	0.795	P17066.pdb.gz	HSP76_HUMAN Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2
4	AFDB:P54652	0.977	0.980	0.000	639	0.822	0.825	P54652.pdb.gz	HSP72_HUMAN Heat shock-related 70 kDa protein 2 OS=Homo sapiens OX=9606 GN=HSPA2 PE=1 SV=1
5	AFDB:Q59EJ3	0.956	0.866	0.000	709	0.891	0.805	Q59EJ3.pdb.gz	Q59EJ3_HUMAN Heat shock 70kDa protein 1A variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:Q5KT34	0.958	0.954	0.000	644	0.836	0.832	Q5KT34.pdb.gz	Q5KT34_ONCMY Heat shock 70kDa protein OS=Oncorhynchus mykiss OX=8022 GN=HSP70b PE=2 SV=1
7	AFDB:Q9IAC1	0.957	0.932	3.483E-104	658	0.833	0.812	Q9IAC1.pdb.gz
8	AFDB:P27541	0.970	0.965	7.308E-103	644	0.808	0.804	P27541.pdb.gz	HSP70_BRUMA Heat shock 70 kDa protein OS=Brugia malayi OX=6279 GN=HSP70 PE=3 SV=1
9	AFDB:P11147	0.953	0.938	2.199E-102	651	0.807	0.794	P11147.pdb.gz	HSP7D_DROME Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster OX=7227 GN=Hsc70-4 PE=1 SV=3
10	AFDB:P02825	0.961	0.959	4.915E-100	642	0.743	0.741	P02825.pdb.gz	HSP71_DROME Major heat shock 70 kDa protein Ab OS=Drosophila melanogaster OX=7227 GN=Hsp70Ab PE=2 SV=3
11	PDB:6asyA	0.873	0.921	1.418E-78	606	0.599	0.634	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
12	PDB:7kw7C	0.567	0.704	1.286E-76	511	0.736	0.924	7kw7C.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
13	PDB:5fpnA	0.537	0.872	1.135E-58	379	0.512	0.865	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
14	PDB:7krwA	0.651	0.683	3.249E-58	608	0.468	0.493	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
15	PDB:2qxlB	0.804	0.824	5.992E-50	625	0.259	0.266	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
16	PDB:3c7nA	0.803	0.794	2.327E-46	649	0.264	0.260	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine
17	PDB:6sr6C	0.549	0.664	3.493E-42	524	0.218	0.267	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
18	PDB:7x3kB	0.555	0.692	7.784E-42	506	0.226	0.287	7x3kB.pdb.gz
19	PDB:6w6eI	0.499	0.867	1.358E-37	357	0.275	0.493	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
20	PDB:1jcfA	0.415	0.753	7.301E-16	336	0.133	0.253	1jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D5PFJ6	1096	638	0.813	0.817	A0A1D5PFJ6_CHICK Heat shock 70kDa protein 8 OS=Gallus gallus OX=9031 GN=HSPA8 PE=1 SV=2
2	A0A1D8PG96	763	687	0.593	0.553	A0A1D8PG96_CANAL Endoplasmic reticulum chaperone BiP OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KAR2 PE=3 SV=1
3	A0A384P5G6	579	679	0.477	0.451	A0A384P5G6_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 PE=2 SV=1
4	A0A509AJG0	762	651	0.580	0.571	BIP_PLABA Endoplasmic reticulum chaperone BIP OS=Plasmodium berghei (strain Anka) OX=5823 GN=BIP PE=1 SV=1
5	A0PA16	1097	646	0.813	0.807	A0PA16_COTJA Heat shock protein 70kDa OS=Coturnix japonica OX=93934 GN=HSPA8 PE=2 SV=1
6	A0QQC8	542	622	0.452	0.466	DNAK_MYCS2 Chaperone protein DnaK OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=dnaK PE=1 SV=1
7	A1A766	544	638	0.473	0.475	DNAK_ECOK1 Chaperone protein DnaK OS=Escherichia coli O1:K1 / APEC OX=405955 GN=dnaK PE=3 SV=1
8	A5I640	540	623	0.473	0.486	DNAK_CLOBH Chaperone protein DnaK OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) OX=441771 GN=dnaK PE=3 SV=1
9	A8WFS0	1129	643	0.842	0.840	A8WFS0_DANRE Heat shock cognate 70-kd protein, like OS=Danio rerio OX=7955 GN=LOC560210 PE=2 SV=1
10	B0UXS6	1132	643	0.846	0.843	B0UXS6_DANRE Heat shock 70 kDa protein isoform X2 OS=Danio rerio OX=7955 GN=zgc:174006 PE=2 SV=1
11	B3VHV2	1069	634	0.810	0.819	B3VHV2_CHICK Heat shock protein 70 OS=Gallus gallus OX=9031 GN=HSP70 PE=2 SV=1
12	B5X397	798	657	0.610	0.595	B5X397_SALSA 78 kDa glucose-regulated protein OS=Salmo salar OX=8030 GN=GRP78 PE=2 SV=1
13	B6EAX2	1074	634	0.813	0.822	B6EAX2_CHICK Heat shock protein 70 OS=Gallus gallus OX=9031 GN=HSP70 PE=2 SV=1
14	B7GT47	530	631	0.454	0.461	DNAK_BIFLS Chaperone protein DnaK OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) OX=391904 GN=dnaK PE=3 SV=1
15	B9RYP6	834	664	0.632	0.610	B9RYP6_RICCO Heat shock protein, putative OS=Ricinus communis OX=3988 GN=RCOM_1312280 PE=3 SV=1
16	C8Z3H3	937	634	0.725	0.733	C8Z3H3_YEAS8 Ssa1p OS=Saccharomyces cerevisiae (strain Lalvin EC1118 / Prise de mousse) OX=643680 GN=EC1118_1A20_0804g PE=1 SV=1
17	D6RCD7	578	665	0.477	0.460	D6RCD7_HUMAN Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2
18	G3I8R9	809	654	0.619	0.607	BIP_CRIGR Endoplasmic reticulum chaperone BiP OS=Cricetulus griseus OX=10029 GN=HSPA5 PE=1 SV=1
19	G4NAY4	670	614	0.552	0.577	SSB1_MAGO7 Heat shock protein SSB1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) OX=242507 GN=SSB1 PE=1 SV=1
20	G8BEU5	771	684	0.588	0.551	G8BEU5_CANPC Endoplasmic reticulum chaperone BiP OS=Candida parapsilosis (strain CDC 317 / ATCC MYA-4646) OX=578454 GN=CPAR2_213780 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02782 FGGY_C	3.1	19.1	FGGY family of carbohydrate kinases, C-terminal domain
2	PF14450 FtsA	17	17.3	Cell division protein FtsA
3	PF00012 HSP70	1.7e-256	863.8	Hsp70 protein
4	PF06723 MreB_Mbl	5.1e-13	60.2	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364805

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359727	0.980	BAG family molecular chaperone regulator 2
2	9606.ENSP00000358081	0.974	BAG family molecular chaperone regulator 3
3	9606.ENSP00000287322	0.966	BAG family molecular chaperone regulator 4
4	9606.ENSP00000368565	0.961	DnaJ homolog subfamily C member 2
5	9606.ENSP00000262177	0.960	DnaJ homolog subfamily B member 6
6	9606.ENSP00000318687	0.954	Heat shock protein 105 kDa
7	9606.ENSP00000335153	0.954	Heat shock protein HSP 90-alpha
8	9606.ENSP00000351646	0.954	Stress-induced-phosphoprotein 1
9	9606.ENSP00000482075	0.954	Prostaglandin E synthase 3
10	9606.ENSP00000281938	0.950	Heat shock protein beta-8
11	9606.ENSP00000254322	0.948	DnaJ homolog subfamily B member 1
12	9606.ENSP00000433560	0.947	Alpha-crystallin B chain
13	9606.ENSP00000338814	0.946	BAG family molecular chaperone regulator 5
14	9606.ENSP00000216218	0.945	Hsc70-interacting protein
15	9606.ENSP00000283195	0.944	E3 SUMO-protein ligase RanBP2
16	9606.ENSP00000406463	0.942	DnaJ homolog subfamily C member 7
17	9606.ENSP00000369127	0.939	DnaJ homolog subfamily A member 1
18	9606.ENSP00000420514	0.938	BAG family molecular chaperone regulator 1
19	9606.ENSP00000314030	0.935	DnaJ homolog subfamily A member 2
20	9606.ENSP00000352400	0.931	Nuclear pore complex protein Nup214

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.891	enzyme binding
GO:1901363	0.879	heterocyclic compound binding
GO:0097159	0.878	organic cyclic compound binding
GO:0003824	0.614	catalytic activity
GO:0051082	0.355	unfolded protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.985	cellular process
GO:0050896	0.973	response to stimulus
GO:0065007	0.861	biological regulation
GO:0050789	0.826	regulation of biological process
GO:0050794	0.812	regulation of cellular process
GO:0006950	0.709	response to stress
GO:0008152	0.495	metabolic process
GO:0071704	0.476	organic substance metabolic process
GO:0044238	0.456	primary metabolic process
GO:0048518	0.373	positive regulation of biological process
GO:0019222	0.341	regulation of metabolic process
GO:0048522	0.329	positive regulation of cellular process
GO:0060255	0.317	regulation of macromolecule metabolic process
GO:0042221	0.313	response to chemical
GO:0051716	0.306	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0043233	0.995	organelle lumen
GO:0070013	0.994	intracellular organelle lumen
GO:0032991	0.992	protein-containing complex
GO:0005829	0.992	cytosol
GO:0005634	0.991	nucleus
GO:0031981	0.980	nuclear lumen
GO:0005615	0.940	extracellular space
GO:0016020	0.920	membrane
GO:0005654	0.870	nucleoplasm
GO:0043230	0.734	extracellular organelle
GO:0065010	0.723	extracellular membrane-bounded organelle
GO:0070062	0.709	extracellular exosome
GO:0012505	0.415	endomembrane system
GO:0005739	0.335	mitochondrion
GO:0043232	0.320	intracellular non-membrane-bounded organelle
GO:0140513	0.311	nuclear protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]