StarFunc result for job id P34932

User Input

>input (840 residues)
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNA
KNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAM
LLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALA
YGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVL
VNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGT
MNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGK
ELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKV
KVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPA
ENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIEN
EGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLY
EDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKE
DQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCS
PIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024RDQ0	0.839	0.865	0.000	814	0.633	0.654	A0A024RDQ0.pdb.gz
2	AFDB:A0A024RDS1	0.839	0.822	0.000	858	0.644	0.631	A0A024RDS1.pdb.gz
3	AFDB:O95757	0.838	0.839	0.000	839	0.640	0.641	O95757.pdb.gz	HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3
4	AFDB:Q61316	0.914	0.913	0.000	841	0.960	0.958	Q61316.pdb.gz	HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus OX=10090 GN=Hspa4 PE=1 SV=1
5	AFDB:M9MSL3	0.844	0.848	1.547E-85	836	0.430	0.432	M9MSL3.pdb.gz	M9MSL3_DROME Hsc70Cb, isoform G OS=Drosophila melanogaster OX=7227 GN=Hsp110 PE=1 SV=1
6	AFDB:F4HQD4	0.814	0.822	7.224E-85	831	0.390	0.395	F4HQD4.pdb.gz	HSP7P_ARATH Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana OX=3702 GN=HSP70-15 PE=1 SV=1
7	AFDB:Q9VUC1	0.828	0.863	1.449E-84	804	0.421	0.440	Q9VUC1.pdb.gz	Q9VUC1_DROME Hsc70Cb, isoform A OS=Drosophila melanogaster OX=7227 GN=Hsp110 PE=1 SV=1
8	AFDB:Q05036	0.831	0.897	1.293E-80	776	0.413	0.447	Q05036.pdb.gz	HS110_CAEEL Heat shock protein 110 OS=Caenorhabditis elegans OX=6239 GN=hsp-110 PE=3 SV=1
9	AFDB:A0A0A0MSM0	0.679	0.728	1.834E-77	782	0.530	0.569	A0A0A0MSM0.pdb.gz	A0A0A0MSM0_HUMAN Heat shock protein family H (Hsp110) member 1 OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1
10	AFDB:Q6TMK3	0.813	0.882	4.810E-72	772	0.346	0.377	Q6TMK3.pdb.gz	HSP88_DICDI Heat shock protein 88 OS=Dictyostelium discoideum OX=44689 GN=hspH PE=1 SV=1
11	PDB:2qxlB	0.702	0.935	8.261E-64	625	0.305	0.410	2qxlB.pdb.gz	Insights into hsp70 chaperone activity from a crystal structure of the yeast hsp110 Sse1.
12	PDB:3c7nA	0.689	0.881	6.558E-62	649	0.315	0.408	3c7nA.pdb.gz	Structure of the Hsp110:Hsc70 nucleotide exchange machine
13	PDB:6asyA	0.642	0.875	2.523E-52	606	0.235	0.325	6asyA.pdb.gz	Conformation transitions of the polypeptide-binding pocket support an active substrate release from Hsp70s.
14	PDB:7kw7C	0.433	0.697	4.612E-40	511	0.198	0.325	7kw7C.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:5fpnA	0.415	0.872	2.585E-38	379	0.171	0.380	5fpnA.pdb.gz	Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
16	PDB:7krwA	0.498	0.674	1.627E-37	608	0.200	0.276	7krwA.pdb.gz	Conformational equilibria in allosteric control of Hsp70 chaperones.
17	PDB:7x3kB	0.416	0.671	5.556E-33	506	0.149	0.247	7x3kB.pdb.gz
18	PDB:6sr6C	0.418	0.652	5.746E-32	524	0.138	0.221	6sr6C.pdb.gz	The ribosome-associated complex RAC serves in a relay that directs nascent chains to Ssb.
19	PDB:6w6eI	0.387	0.868	9.149E-30	357	0.140	0.331	6w6eI.pdb.gz	Structural basis for aggregate dissolution and refolding by the Mycobacterium tuberculosis ClpB-DnaK bi-chaperone system.
20	PDB:1jcfA	0.311	0.718	1.003E-13	336	0.085	0.211	1jcfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSM0	0.0	757	782	0.444	0.477	A0A0A0MSM0_HUMAN Heat shock protein family H (Hsp110) member 1 OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1
2	F4HQD4	0.0	605	831	0.398	0.402	HSP7P_ARATH Heat shock 70 kDa protein 15 OS=Arabidopsis thaliana OX=3702 GN=HSP70-15 PE=1 SV=1
3	M9MSL3	0.0	668	836	0.431	0.433	M9MSL3_DROME Hsc70Cb, isoform G OS=Drosophila melanogaster OX=7227 GN=Hsp110 PE=1 SV=1
4	O88600	0.0	1626	840	0.958	0.958	HSP74_RAT Heat shock 70 kDa protein 4 OS=Rattus norvegicus OX=10116 GN=Hspa4 PE=1 SV=1
5	O95757	0.0	1123	839	0.645	0.646	HS74L_HUMAN Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3
6	P34932	0.0	1738	840	1.000	1.000	HSP74_HUMAN Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4
7	P48722	0.0	1115	838	0.632	0.634	HS74L_MOUSE Heat shock 70 kDa protein 4L OS=Mus musculus OX=10090 GN=Hspa4l PE=1 SV=2
8	Q05036	0.0	619	776	0.401	0.434	HS110_CAEEL Heat shock protein 110 OS=Caenorhabditis elegans OX=6239 GN=hsp-110 PE=3 SV=1
9	Q2TFN9	0.0	1691	840	0.973	0.973	HSP74_CANLF Heat shock 70 kDa protein 4 OS=Canis lupus familiaris OX=9615 GN=HSPA4 PE=1 SV=1
10	Q60446	0.0	1056	858	0.627	0.614	HS105_CRIGR Heat shock protein 105 kDa OS=Cricetulus griseus OX=10029 GN=HSPH1 PE=2 SV=1
11	Q61316	0.0	1596	841	0.956	0.955	HSP74_MOUSE Heat shock 70 kDa protein 4 OS=Mus musculus OX=10090 GN=Hspa4 PE=1 SV=1
12	Q61699	0.0	1098	858	0.642	0.628	HS105_MOUSE Heat shock protein 105 kDa OS=Mus musculus OX=10090 GN=Hsph1 PE=1 SV=2
13	Q92598	0.0	1115	858	0.642	0.628	HS105_HUMAN Heat shock protein 105 kDa OS=Homo sapiens OX=9606 GN=HSPH1 PE=1 SV=1
14	Q9S7C0	0.0	607	831	0.398	0.402	HSP7O_ARATH Heat shock 70 kDa protein 14 OS=Arabidopsis thaliana OX=3702 GN=HSP70-14 PE=1 SV=1
15	Q9VUC1	0.0	616	804	0.408	0.427	Q9VUC1_DROME Hsc70Cb, isoform A OS=Drosophila melanogaster OX=7227 GN=Hsp110 PE=1 SV=1
16	Q9XZT5	0.0	612	804	0.407	0.425	Q9XZT5_DROME Heatshock protein cognate 70Cb OS=Drosophila melanogaster OX=7227 GN=Hsp110 PE=3 SV=1
17	O59838	2.50e-178	532	720	0.354	0.412	HSP7F_SCHPO Heat shock protein homolog pss1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pss1 PE=1 SV=2
18	Q6TMK3	3.84e-165	500	772	0.352	0.383	HSP88_DICDI Heat shock protein 88 OS=Dictyostelium discoideum OX=44689 GN=hspH PE=1 SV=1
19	P32590	5.93e-150	458	693	0.315	0.382	HSP79_YEAST Heat shock protein homolog SSE2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SSE2 PE=1 SV=3
20	Q96VB9	6.21e-149	456	701	0.318	0.381	HSP7F_CANAL Heat shock protein homolog SSE1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSI3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13013 F-box-like_2	2.6e+02	13.0	F-box-like domain
2	PF03584 Herpes_ICP4_N	4.2e+02	12.2	Herpesvirus ICP4-like protein N-terminal region
3	PF00012 HSP70	2.5e-212	718.0	Hsp70 protein
4	PF06723 MreB_Mbl	0.00012	32.6	MreB/Mbl protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302961

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219548	0.999	E3 ubiquitin-protein ligase CHIP
2	9606.ENSP00000254322	0.999	DnaJ homolog subfamily B member 1
3	9606.ENSP00000262177	0.999	DnaJ homolog subfamily B member 6
4	9606.ENSP00000335153	0.999	Heat shock protein HSP 90-alpha
5	9606.ENSP00000338345	0.999	Alpha-synuclein
6	9606.ENSP00000351646	0.999	Stress-induced-phosphoprotein 1
7	9606.ENSP00000358081	0.999	BAG family molecular chaperone regulator 3
8	9606.ENSP00000359727	0.999	BAG family molecular chaperone regulator 2
9	9606.ENSP00000420514	0.999	BAG family molecular chaperone regulator 1
10	9606.ENSP00000216218	0.998	Hsc70-interacting protein
11	9606.ENSP00000269305	0.998	Cellular tumor antigen p53
12	9606.ENSP00000368565	0.998	DnaJ homolog subfamily C member 2
13	9606.ENSP00000003084	0.997	Cystic fibrosis transmembrane conductance regulator
14	9606.ENSP00000262375	0.997	DnaJ homolog subfamily A member 3, mitochondrial
15	9606.ENSP00000338814	0.997	BAG family molecular chaperone regulator 5
16	9606.ENSP00000437955	0.997	Hypoxia-inducible factor 1-alpha
17	9606.ENSP00000255631	0.996	Hsp70-binding protein 1
18	9606.ENSP00000270538	0.996	Mitochondrial import inner membrane translocase subunit TIM44
19	9606.ENSP00000448165	0.996	Apoptotic protease-activating factor 1
20	9606.ENSP00000221566	0.995	Small glutamine-rich tetratricopeptide repeat-containing protein alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.525	heterocyclic compound binding
GO:0097159	0.520	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.977	cellular process
GO:0065007	0.906	biological regulation
GO:0050789	0.903	regulation of biological process
GO:0050896	0.898	response to stimulus
GO:0050794	0.871	regulation of cellular process
GO:0072594	0.810	establishment of protein localization to organelle
GO:0006839	0.809	mitochondrial transport
GO:0070585	0.795	protein localization to mitochondrion
GO:0071840	0.773	cellular component organization or biogenesis
GO:0019222	0.764	regulation of metabolic process
GO:0007005	0.758	mitochondrion organization
GO:0072655	0.730	establishment of protein localization to mitochondrion
GO:0006886	0.698	intracellular protein transport
GO:0051668	0.685	localization within membrane
GO:0006950	0.673	response to stress
GO:0048518	0.660	positive regulation of biological process
GO:0060255	0.656	regulation of macromolecule metabolic process
GO:0080090	0.598	regulation of primary metabolic process
GO:0051171	0.578	regulation of nitrogen compound metabolic process
GO:0061024	0.564	membrane organization
GO:0072657	0.533	protein localization to membrane
GO:0006605	0.517	protein targeting
GO:0090150	0.510	establishment of protein localization to membrane
GO:0048522	0.497	positive regulation of cellular process
GO:0031323	0.461	regulation of cellular metabolic process
GO:0048519	0.437	negative regulation of biological process
GO:0007006	0.436	mitochondrial membrane organization
GO:0010468	0.433	regulation of gene expression
GO:0008152	0.421	metabolic process
GO:0010604	0.420	positive regulation of macromolecule metabolic process
GO:0048523	0.394	negative regulation of cellular process
GO:0071704	0.371	organic substance metabolic process
GO:0009889	0.371	regulation of biosynthetic process
GO:0051246	0.348	regulation of protein metabolic process
GO:0042221	0.330	response to chemical
GO:0051716	0.322	cellular response to stimulus
GO:0051173	0.316	positive regulation of nitrogen compound metabolic process
GO:0044238	0.306	primary metabolic process
GO:0006807	0.306	nitrogen compound metabolic process
GO:0032501	0.303	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0043232	0.987	intracellular non-membrane-bounded organelle
GO:0005576	0.969	extracellular region
GO:0070013	0.963	intracellular organelle lumen
GO:0005634	0.954	nucleus
GO:0070062	0.903	extracellular exosome
GO:0016020	0.831	membrane
GO:0032991	0.646	protein-containing complex
GO:0031981	0.608	nuclear lumen
GO:0005654	0.394	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]