StarFunc result for job id P34949

User Input

>input (423 residues)
MAAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAK
ILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEK
LHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLK
QTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQ
LHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTP
KFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYK
VLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRAC
CLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P34949	1.000	1.000	3.631E-90	423	1.000	1.000	P34949.pdb.gz	MPI_HUMAN Mannose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=MPI PE=1 SV=2
2	AFDB:Q924M7	0.995	0.995	2.845E-79	423	0.846	0.846	Q924M7.pdb.gz	MPI_MOUSE Mannose-6-phosphate isomerase OS=Mus musculus OX=10090 GN=Mpi PE=1 SV=1
3	AFDB:Q3ZB95	0.990	0.993	1.397E-70	422	0.631	0.633	Q3ZB95.pdb.gz	Q3ZB95_DANRE Mannose-6-phosphate isomerase OS=Danio rerio OX=7955 GN=zgc:110773 PE=1 SV=1
4	AFDB:Q66WM4	0.913	0.847	1.101E-50	457	0.402	0.372	Q66WM4.pdb.gz	MPI_ASPFU Mannose-6-phosphate isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pmi1 PE=2 SV=2
5	AFDB:Q9FZH5	0.914	0.878	7.580E-50	441	0.388	0.372	Q9FZH5.pdb.gz	MPI2_ARATH Mannose-6-phosphate isomerase 2 OS=Arabidopsis thaliana OX=3702 GN=PMI2 PE=1 SV=1
6	AFDB:Q9M884	0.920	0.902	8.464E-50	432	0.400	0.391	Q9M884.pdb.gz	MPI1_ARATH Mannose-6-phosphate isomerase 1 OS=Arabidopsis thaliana OX=3702 GN=PMI1 PE=1 SV=1
7	AFDB:O43014	0.897	0.921	5.220E-49	412	0.376	0.386	O43014.pdb.gz	MPI_SCHPO Mannose-6-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmi40 PE=3 SV=1
8	AFDB:P34948	0.919	0.883	6.877E-49	441	0.395	0.379	P34948.pdb.gz	MPI_CANAL Mannose-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMI1 PE=1 SV=2
9	AFDB:P29952	0.910	0.898	1.333E-48	429	0.385	0.380	P29952.pdb.gz	MPI_YEAST Mannose-6-phosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMI40 PE=1 SV=4
10	PDB:5nw7A	0.908	0.875	6.722E-46	440	0.392	0.377	5nw7A.pdb.gz	Crystal structure of phosphomannose isomerase from Candida albicans complexed with 5-phospho-d-arabinonhydrazide.
11	AFDB:Q4Q5C3	0.850	0.854	5.116E-42	421	0.357	0.359	Q4Q5C3.pdb.gz	Q4Q5C3_LEIMA mannose-6-phosphate isomerase OS=Leishmania major OX=5664 GN=PMI PE=3 SV=1
12	PDB:6l4cC	0.382	0.447	2.098E-8	353	0.092	0.110	6l4cC.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
13	PDB:2vqaA	0.331	0.384	3.087E-8	356	0.061	0.073	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
14	PDB:6l4cB	0.366	0.407	1.802E-7	373	0.087	0.099	6l4cB.pdb.gz	Comparative study of 7S globulin from Corylus avellana and Solanum lycopersicum revealed importance of salicylic acid and Cu-binding loop in modulating their function.
15	PDB:4lejA	0.366	0.426	2.508E-7	355	0.080	0.096	4lejA.pdb.gz	Crystal Structure of Korean Pine ( Pinus koraiensis ) 7S Seed Storage Protein with Copper Ligands.
16	PDB:2qnkA	0.278	0.382	4.599E-7	286	0.078	0.115	2qnkA.pdb.gz
17	PDB:1uijC	0.332	0.395	5.734E-7	346	0.066	0.081	1uijC.pdb.gz
18	PDB:3fz3B	0.305	0.314	6.402E-7	410	0.064	0.066	3fz3B.pdb.gz	Crystal structure of prunin-1, a major component of the almond (Prunus dulcis) allergen amandin.
19	PDB:1ipkC	0.329	0.362	1.174E-6	379	0.071	0.079	1ipkC.pdb.gz
20	PDB:1fxzA	0.307	0.343	1.727E-6	371	0.078	0.089	1fxzA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34949	0.0	875	423	1.000	1.000	MPI_HUMAN Mannose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=MPI PE=1 SV=2
2	Q3ZB95	0.0	566	422	0.634	0.635	Q3ZB95_DANRE Mannose-6-phosphate isomerase OS=Danio rerio OX=7955 GN=zgc:110773 PE=1 SV=1
3	Q924M7	0.0	750	423	0.846	0.846	MPI_MOUSE Mannose-6-phosphate isomerase OS=Mus musculus OX=10090 GN=Mpi PE=1 SV=1
4	P34948	2.71e-100	307	441	0.418	0.401	MPI_CANAL Mannose-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMI1 PE=1 SV=2
5	Q9M884	2.97e-98	302	432	0.400	0.391	MPI1_ARATH Mannose-6-phosphate isomerase 1 OS=Arabidopsis thaliana OX=3702 GN=PMI1 PE=1 SV=1
6	Q66WM4	5.28e-98	302	457	0.428	0.396	MPI_ASPFU Mannose-6-phosphate isomerase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=pmi1 PE=2 SV=2
7	P29952	1.89e-95	295	429	0.402	0.396	MPI_YEAST Mannose-6-phosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMI40 PE=1 SV=4
8	Q9FZH5	3.17e-95	295	441	0.407	0.390	MPI2_ARATH Mannose-6-phosphate isomerase 2 OS=Arabidopsis thaliana OX=3702 GN=PMI2 PE=1 SV=1
9	O43014	1.71e-90	281	412	0.383	0.393	MPI_SCHPO Mannose-6-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pmi40 PE=3 SV=1
10	Q4Q5C3	1.55e-77	248	421	0.350	0.352	Q4Q5C3_LEIMA mannose-6-phosphate isomerase OS=Leishmania major OX=5664 GN=PMI PE=3 SV=1
11	Q381V7	1.88e-74	240	409	0.333	0.345	Q381V7_TRYB2 mannose-6-phosphate isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6410 PE=3 SV=1
12	P00946	2.01e-54	187	391	0.329	0.355	MANA_ECOLI Mannose-6-phosphate isomerase OS=Escherichia coli (strain K12) OX=83333 GN=manA PE=1 SV=1
13	O05898	1.24e-52	183	408	0.322	0.333	O05898_MYCTU mannose-6-phosphate isomerase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=manA PE=1 SV=1
14	O51368	3.42e-40	149	372	0.270	0.306	O51368_BORBU mannose-6-phosphate isomerase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=manA PE=3 SV=1
15	Q9CHG2	3.57e-04	44.7	315	0.069	0.092	Q9CHG2_LACLA Mannose-6-phosphate isomerase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=pmi PE=3 SV=1
16	Q7KAJ2	2.1	33.5	2285	0.057	0.011	Q7KAJ2_DROME Kakapo (Fragment) OS=Drosophila melanogaster OX=7227 GN=shot PE=2 SV=1
17	A1Z9I8	3.0	32.7	5385	0.057	0.004	A1Z9I8_DROME Short stop, isoform G OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
18	B7YZG2	3.0	32.7	5370	0.057	0.004	B7YZG2_DROME Short stop, isoform K OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
19	B7YZG3	3.0	32.7	5375	0.057	0.004	B7YZG3_DROME Short stop, isoform I OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1
20	A1Z9I9	3.1	32.7	5390	0.057	0.004	A1Z9I9_DROME Short stop, isoform B OS=Drosophila melanogaster OX=7227 GN=shot PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01238 PMI_typeI_C	8.9e-11	53.1	Phosphomannose isomerase type I C-terminal
2	PF20511 PMI_typeI_cat	2e-59	211.3	Phosphomannose isomerase type I, catalytic domain
3	PF20512 PMI_typeI_hel	2.2e-24	97.1	Phosphomannose isomerase type I, helical insertion domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318318

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405573	0.992	Glucose-6-phosphate isomerase
2	9606.ENSP00000268261	0.987	Phosphomannomutase 2
3	9606.ENSP00000216259	0.971	Phosphomannomutase 1
4	9606.ENSP00000402103	0.959	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
5	9606.ENSP00000346643	0.949	Putative hexokinase HKDC1
6	9606.ENSP00000292432	0.947	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
7	9606.ENSP00000423674	0.944	Glucosamine-6-phosphate isomerase 1
8	9606.ENSP00000364486	0.941	Fructose-1,6-bisphosphatase isozyme 2
9	9606.ENSP00000408025	0.941	Fructose-1,6-bisphosphatase 1
10	9606.ENSP00000349860	0.936	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
11	9606.ENSP00000290573	0.934	Hexokinase-2
12	9606.ENSP00000345771	0.932	ATP-dependent 6-phosphofructokinase, muscle type
13	9606.ENSP00000295448	0.931	Glucosamine-6-phosphate deaminase 2
14	9606.ENSP00000370517	0.928	ATP-dependent 6-phosphofructokinase, platelet type
15	9606.ENSP00000269848	0.927	ATP-dependent 6-phosphofructokinase, liver type
16	9606.ENSP00000253778	0.920	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2
17	9606.ENSP00000179259	0.915	Fructose-2,6-bisphosphatase TIGAR
18	9606.ENSP00000232375	0.908	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4
19	9606.ENSP00000356047	0.908	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2
20	9606.ENSP00000364145	0.908	6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004476	1.000	mannose-6-phosphate isomerase activity
GO:0005488	0.983	binding
GO:0005515	0.967	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901135	0.998	carbohydrate derivative metabolic process
GO:0055086	0.997	nucleobase-containing small molecule metabolic process
GO:0009226	0.988	nucleotide-sugar biosynthetic process
GO:1901564	0.567	organonitrogen compound metabolic process
GO:0005975	0.479	carbohydrate metabolic process
GO:0006793	0.393	phosphorus metabolic process
GO:0006796	0.380	phosphate-containing compound metabolic process
GO:0019637	0.378	organophosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005829	1.000	cytosol
GO:0005576	0.985	extracellular region
GO:1903561	0.966	extracellular vesicle
GO:0070062	0.963	extracellular exosome
GO:0043231	0.928	intracellular membrane-bounded organelle
GO:0005634	0.355	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:12356	1.000	D-mannose 6-phosphate = D-fructose 6-phosphate
EC:5.3.1.8	1.000	mannose-6-phosphate isomerase.

[back to server]