StarFunc result for job id P34995

User Input

>input (402 residues)
MSPCGPLNLSLAGEATTCAAPWVPNTSAVPPSGASPALPIFSMTLGAVSNLLALALLAQA
AGRLRRRRSAATFLLFVASLLATDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMVFF
GLCPLLLGCGMAVERCVGVTRPLLHAARVSVARARLALAAVAAVALAVALLPLARVGRYE
LQYPGTWCFIGLGPPGGWRQALLAGLFASLGLVALLAALVCNTLSGLALLRARWRRRSRR
PPPASGPDSRRRWGAHGPRSASASSASSIASASTFFGGSRSSGSARRARAHDVEMVGQLV
GIMVVSCICWSPMLVLVALAVGGWSSTSLQRPLFLAVRLASWNQILDPWVYILLRQAVLR
QLLRLLPPRAGAKGGPAGLGLTPSAWEASSLRSSRHSGLSHF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P34995	1.000	1.000	9.516E-51	402	1.000	1.000	P34995.pdb.gz	PE2R1_HUMAN Prostaglandin E2 receptor EP1 subtype OS=Homo sapiens OX=9606 GN=PTGER1 PE=2 SV=3
2	AFDB:P35375	0.745	0.740	6.944E-40	405	0.853	0.847	P35375.pdb.gz	PE2R1_MOUSE Prostaglandin E2 receptor EP1 subtype OS=Mus musculus OX=10090 GN=Ptger1 PE=2 SV=1
3	AFDB:D0EXE2	0.700	0.720	7.237E-24	390	0.455	0.469	D0EXE2.pdb.gz	D0EXE2_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=ptger1a PE=2 SV=1
4	AFDB:D0EXE3	0.658	0.708	2.827E-23	373	0.413	0.445	D0EXE3.pdb.gz	D0EXE3_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=ptger1b PE=2 SV=1
5	AFDB:A0A2R8Q772	0.689	0.735	1.317E-22	376	0.398	0.426	A0A2R8Q772.pdb.gz
6	AFDB:D7R7W5	0.665	0.684	6.098E-19	390	0.358	0.369	D7R7W5.pdb.gz	D7R7W5_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=FP PE=2 SV=1
7	AFDB:P43088	0.642	0.715	1.288E-18	359	0.306	0.343	P43088.pdb.gz	PF2R_HUMAN Prostaglandin F2-alpha receptor OS=Homo sapiens OX=9606 GN=PTGFR PE=1 SV=1
8	AFDB:P43117	0.655	0.716	1.469E-18	366	0.299	0.328	P43117.pdb.gz	PF2R_MOUSE Prostaglandin F2-alpha receptor OS=Mus musculus OX=10090 GN=Ptgfr PE=2 SV=1
9	AFDB:E7FD73	0.632	0.634	5.998E-18	401	0.306	0.307	E7FD73.pdb.gz	E7FD73_DANRE Prostaglandin E2 receptor EP3 subtype OS=Danio rerio OX=7955 GN=ptger3 PE=4 SV=1
10	AFDB:T2HVK6	0.667	0.720	1.016E-17	371	0.296	0.321	T2HVK6.pdb.gz	T2HVK6_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=tbxa2r PE=2 SV=1
11	PDB:6m9tA	0.625	0.568	3.744E-12	444	0.284	0.257	6m9tA.pdb.gz	Crystal structure of misoprostol bound to the labor inducer prostaglandin E2receptor.
12	PDB:7cx2R	0.591	0.871	2.173E-11	266	0.224	0.338	7cx2R.pdb.gz	Ligand recognition, unconventional activation, and G protein coupling of the prostaglandin E 2 receptor EP2 subtype.
13	PDB:7e32R	0.520	0.709	4.979E-8	285	0.119	0.168	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
14	PDB:7wv9R	0.547	0.737	9.628E-8	290	0.154	0.214	7wv9R.pdb.gz	Molecular mechanism of allosteric modulation for the cannabinoid receptor CB1.
15	PDB:3aymA	0.600	0.681	1.562E-7	350	0.127	0.146	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
16	PDB:6g79S	0.455	0.656	2.319E-7	262	0.127	0.195	6g79S.pdb.gz	Cryo-EM structure of the serotonin 5-HT1Breceptor coupled to heterotrimeric Go.
17	PDB:7wvuR	0.491	0.637	2.890E-7	298	0.132	0.178	7wvuR.pdb.gz	Structural basis of FPR2 in recognition of A beta 42 and neuroprotection by humanin.
18	PDB:6pt0R	0.558	0.731	4.485E-7	298	0.129	0.174	6pt0R.pdb.gz	Cryo-EM Structure of the Human Cannabinoid Receptor CB2-GiSignaling Complex.
19	PDB:8ef5M	0.496	0.660	5.347E-7	288	0.137	0.191	8ef5M.pdb.gz	Molecular recognition of morphine and fentanyl by the human mu-opioid receptor.
20	PDB:6gdgA	0.480	0.689	5.587E-7	264	0.142	0.216	6gdgA.pdb.gz	Cryo-EM structure of the adenosine A2Areceptor coupled to an engineered heterotrimeric G protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34995	0.0	762	402	1.000	1.000	PE2R1_HUMAN Prostaglandin E2 receptor EP1 subtype OS=Homo sapiens OX=9606 GN=PTGER1 PE=2 SV=3
2	P35375	1.17e-171	487	405	0.843	0.837	PE2R1_MOUSE Prostaglandin E2 receptor EP1 subtype OS=Mus musculus OX=10090 GN=Ptger1 PE=2 SV=1
3	P70597	1.55e-168	479	405	0.838	0.832	PE2R1_RAT Prostaglandin E2 receptor EP1 subtype OS=Rattus norvegicus OX=10116 GN=Ptger1 PE=2 SV=1
4	D0EXE2	2.03e-105	318	390	0.433	0.446	D0EXE2_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=ptger1a PE=2 SV=1
5	F1QIS8	2.94e-94	289	373	0.420	0.453	F1QIS8_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=ptger1b PE=4 SV=1
6	D0EXE3	6.36e-93	285	373	0.418	0.450	D0EXE3_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=ptger1b PE=2 SV=1
7	D0EXE4	1.92e-74	238	376	0.386	0.412	D0EXE4_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=ptger1c PE=2 SV=1
8	P43088	2.07e-69	224	359	0.336	0.376	PF2R_HUMAN Prostaglandin F2-alpha receptor OS=Homo sapiens OX=9606 GN=PTGFR PE=1 SV=1
9	P43117	1.29e-65	215	366	0.328	0.361	PF2R_MOUSE Prostaglandin F2-alpha receptor OS=Mus musculus OX=10090 GN=Ptgfr PE=2 SV=1
10	D7R7W5	3.93e-59	199	390	0.341	0.351	D7R7W5_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=FP PE=2 SV=1
11	T2HVK6	6.43e-49	171	371	0.296	0.321	T2HVK6_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=tbxa2r PE=2 SV=1
12	P21731	4.37e-45	160	343	0.351	0.411	TA2R_HUMAN Thromboxane A2 receptor OS=Homo sapiens OX=9606 GN=TBXA2R PE=1 SV=3
13	E7FD73	3.29e-44	160	401	0.289	0.289	E7FD73_DANRE Prostaglandin E2 receptor EP3 subtype OS=Danio rerio OX=7955 GN=ptger3 PE=4 SV=1
14	P34978	3.00e-42	153	341	0.316	0.372	TA2R_RAT Thromboxane A2 receptor OS=Rattus norvegicus OX=10116 GN=Tbxa2r PE=2 SV=1
15	P30987	2.29e-40	148	341	0.308	0.364	TA2R_MOUSE Thromboxane A2 receptor OS=Mus musculus OX=10090 GN=Tbxa2r PE=1 SV=1
16	P30557	5.63e-39	145	365	0.296	0.326	PE2R3_MOUSE Prostaglandin E2 receptor EP3 subtype OS=Mus musculus OX=10090 GN=Ptger3 PE=1 SV=1
17	P43115	1.05e-38	145	390	0.303	0.313	PE2R3_HUMAN Prostaglandin E2 receptor EP3 subtype OS=Homo sapiens OX=9606 GN=PTGER3 PE=1 SV=1
18	P34980	2.92e-36	137	365	0.281	0.310	PE2R3_RAT Prostaglandin E2 receptor EP3 subtype OS=Rattus norvegicus OX=10116 GN=Ptger3 PE=1 SV=1
19	Q2N1D9	5.93e-36	137	403	0.271	0.270	Q2N1D9_DANRE Prostaglandin E2 receptor EP4 subtype OS=Danio rerio OX=7955 GN=ptger4 PE=2 SV=1
20	C0HB24	6.18e-33	130	472	0.251	0.214	C0HB24_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 GN=PE2R4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5.3e-17	73.5	7 transmembrane receptor (rhodopsin family)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000292513

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286548	0.990	Guanine nucleotide-binding protein G(q) subunit alpha
2	9606.ENSP00000305372	0.946	Beta-2 adrenergic receptor
3	9606.ENSP00000310305	0.928	P2Y purinoceptor 2
4	9606.ENSP00000409581	0.926	Beta-arrestin-1
5	9606.ENSP00000312262	0.923	Beta-adrenergic receptor kinase 1
6	9606.ENSP00000368683	0.922	Endothelin-1
7	9606.ENSP00000360141	0.919	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
8	9606.ENSP00000386884	0.915	C-X-C chemokine receptor type 4
9	9606.ENSP00000379140	0.914	Stromal cell-derived factor 1
10	9606.ENSP00000481878	0.912	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
11	9606.ENSP00000306490	0.906	Muscarinic acetylcholine receptor M1
12	9606.ENSP00000276198	0.905	5-hydroxytryptamine receptor 2C
13	9606.ENSP00000292303	0.905	C-C chemokine receptor type 5
14	9606.ENSP00000302234	0.905	Eotaxin
15	9606.ENSP00000308541	0.905	Prothrombin
16	9606.ENSP00000471493	0.905	fMet-Leu-Phe receptor
17	9606.ENSP00000482259	0.905	C-C motif chemokine 4
18	9606.ENSP00000441600	0.904	C-C chemokine receptor type 3
19	9606.ENSP00000306662	0.903	Alpha-1B adrenergic receptor
20	9606.ENSP00000360973	0.903	Type-2 angiotensin II receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004957	0.995	prostaglandin E receptor activity
GO:0005515	0.977	protein binding
GO:0005102	0.300	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.997	signal transduction
GO:0007186	0.992	G protein-coupled receptor signaling pathway
GO:0042221	0.517	response to chemical
GO:0048519	0.405	negative regulation of biological process
GO:0070887	0.404	cellular response to chemical stimulus
GO:0010033	0.398	response to organic substance
GO:0048518	0.331	positive regulation of biological process
GO:0071310	0.328	cellular response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043231	0.765	intracellular membrane-bounded organelle
GO:0005737	0.649	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]