StarFunc result for job id P35070

User Input

>input (178 residues)
MDRAARCSGASSLPLLLALALGLVILHCVVADGNSTRSPETNGLLCGDPEENCAATTTQS
KRKGHFSRCPKQYKHYCIKGRCRFVVAEQTPSCVCDEGYIGARCERVDLFYLRGDRGQIL
VICLIAVMVVFIILVIGVCTCCHPLRKRRKRKKKEEEMETLGKDITPINEDIEETNIA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35070	1.000	1.000	2.710E-31	178	1.000	1.000	P35070.pdb.gz	BTC_HUMAN Probetacellulin OS=Homo sapiens OX=9606 GN=BTC PE=1 SV=1
2	AFDB:Q05928	0.796	0.800	6.855E-24	177	0.792	0.797	Q05928.pdb.gz	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
3	AFDB:Q64EU6	0.483	0.499	6.146E-16	171	0.562	0.585	Q64EU6.pdb.gz	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
4	AFDB:P01135	0.376	0.412	1.776E-8	160	0.236	0.263	P01135.pdb.gz	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
5	AFDB:Q6J1M9	0.371	0.408	6.295E-8	156	0.242	0.276	Q6J1M9.pdb.gz	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
6	AFDB:O14944	0.376	0.393	6.729E-8	169	0.202	0.213	O14944.pdb.gz	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
7	AFDB:Q61521	0.320	0.347	9.653E-7	162	0.225	0.247	Q61521.pdb.gz	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
8	AFDB:Q99075	0.309	0.279	1.179E-6	208	0.202	0.173	Q99075.pdb.gz	HBEGF_HUMAN Proheparin-binding EGF-like growth factor OS=Homo sapiens OX=9606 GN=HBEGF PE=1 SV=1
9	AFDB:Q06175	0.293	0.257	1.439E-6	208	0.247	0.212	Q06175.pdb.gz	HBEGF_RAT Proheparin-binding EGF-like growth factor OS=Rattus norvegicus OX=10116 GN=Hbegf PE=2 SV=1
10	AFDB:Q6UW88	0.458	0.513	3.200E-6	154	0.185	0.214	Q6UW88.pdb.gz	EPGN_HUMAN Epigen OS=Homo sapiens OX=9606 GN=EPGN PE=1 SV=2
11	PDB:3t5oA	0.155	0.033	8.262E-1	871	0.056	0.011	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
12	PDB:7nycD	0.149	0.057	8.831E-1	487	0.051	0.018	7nycD.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
13	PDB:5es4B	0.095	0.025	9.439E-1	674	0.051	0.013	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
14	PDB:5f1aA	0.181	0.062	9.439E-1	553	0.056	0.018	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
15	PDB:4rs0A	0.175	0.061	1.009	557	0.062	0.020	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
16	PDB:7nycC	0.138	0.031	1.009	809	0.045	0.010	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
17	PDB:7q3nU	0.138	0.090	1.078	292	0.062	0.038	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
18	PDB:4uhvB	0.133	0.050	1.317	645	0.090	0.025	4uhvB.pdb.gz
19	PDB:2hoxD	0.169	0.074	1.407	427	0.056	0.023	2hoxD.pdb.gz	Two Structures of Alliinase from Alliium sativum L.: Apo Form and Ternary Complex with Aminoacrylate Reaction Intermediate Covalently Bound to the PLP Cofactor.
20	PDB:6y3cA	0.172	0.059	1.608	557	0.079	0.025	6y3cA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35070	4.09e-130	363	178	1.000	1.000	BTC_HUMAN Probetacellulin OS=Homo sapiens OX=9606 GN=BTC PE=1 SV=1
2	A0A8J8YRH0	3.55e-84	248	191	0.702	0.654	A0A8J8YRH0_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
3	A0A8I6AQ55	5.71e-81	240	199	0.674	0.603	A0A8I6AQ55_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
4	A0A8I5ZSF9	1.74e-80	239	193	0.674	0.622	A0A8I5ZSF9_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=4 SV=1
5	Q9JJM4	4.82e-80	237	177	0.770	0.774	Q9JJM4_RAT Betacellulin OS=Rattus norvegicus OX=10116 GN=Btc PE=2 SV=1
6	Q05928	1.86e-71	215	177	0.669	0.672	BTC_MOUSE Probetacellulin OS=Mus musculus OX=10090 GN=Btc PE=1 SV=1
7	Q64EU6	5.70e-61	188	171	0.522	0.544	Q64EU6_CHICK Betacellulin OS=Gallus gallus OX=9031 GN=BTC PE=2 SV=1
8	P01135	2.01e-15	71.6	160	0.258	0.287	TGFA_HUMAN Protransforming growth factor alpha OS=Homo sapiens OX=9606 GN=TGFA PE=1 SV=1
9	P48030	5.12e-15	70.9	159	0.174	0.195	TGFA_MOUSE Protransforming growth factor alpha OS=Mus musculus OX=10090 GN=Tgfa PE=1 SV=1
10	P01134	5.88e-15	70.5	159	0.174	0.195	TGFA_RAT Protransforming growth factor alpha OS=Rattus norvegicus OX=10116 GN=Tgfa PE=1 SV=2
11	Q6J1M9	1.63e-12	63.9	156	0.129	0.147	Q6J1M9_CHICK Transforming growth factor alpha OS=Gallus gallus OX=9031 PE=2 SV=1
12	Q8IYR6	7.84e-11	61.6	380	0.213	0.100	TEFF1_HUMAN Tomoregulin-1 OS=Homo sapiens OX=9606 GN=TMEFF1 PE=1 SV=1
13	Q9UIK5	6.98e-09	56.2	374	0.202	0.096	TEFF2_HUMAN Tomoregulin-2 OS=Homo sapiens OX=9606 GN=TMEFF2 PE=1 SV=1
14	A9JRW9	2.85e-08	53.5	230	0.174	0.135	A9JRW9_DANRE Heparin-binding EGF-like growth factor a OS=Danio rerio OX=7955 GN=hbegfa PE=2 SV=1
15	Q61521	4.21e-08	52.4	162	0.225	0.247	EREG_MOUSE Proepiregulin OS=Mus musculus OX=10090 GN=Ereg PE=1 SV=1
16	O14944	1.38e-07	50.8	169	0.202	0.213	EREG_HUMAN Proepiregulin OS=Homo sapiens OX=9606 GN=EREG PE=1 SV=1
17	Q9Z0L5	1.14e-06	48.5	162	0.202	0.222	EREG_RAT Proepiregulin OS=Rattus norvegicus OX=10116 GN=Ereg PE=1 SV=1
18	Q99075	5.07e-06	47.0	208	0.129	0.111	HBEGF_HUMAN Proheparin-binding EGF-like growth factor OS=Homo sapiens OX=9606 GN=HBEGF PE=1 SV=1
19	Q06186	6.87e-06	46.6	208	0.140	0.120	HBEGF_MOUSE Proheparin-binding EGF-like growth factor OS=Mus musculus OX=10090 GN=Hbegf PE=2 SV=1
20	Q06175	2.43e-05	45.1	208	0.112	0.096	HBEGF_RAT Proheparin-binding EGF-like growth factor OS=Rattus norvegicus OX=10116 GN=Hbegf PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06143 Baculo_11_kDa	64	14.6	Baculovirus 11 kDa family
2	PF16492 Cadherin_C_2	6.8	18.8	Cadherin cytoplasmic C-terminal
3	PF06365 CD34_antigen	1.9e+02	13.1	CD34/Podocalyxin family
4	PF05454 DAG1	3.1e+02	12.1	Dystroglycan (Dystrophin-associated glycoprotein 1)
5	PF10864 DUF2663	5.2e+02	12.4	Protein of unknown function (DUF2663)
6	PF19904 DUF6377	4.6e+02	11.7	Domain of unknown function (DUF6377)
7	PF19962 EAD9	2.6e+02	12.8	Effector-associated domain 9
8	PF00008 EGF	0.35	22.5	EGF-like domain
9	PF14575 EphA2_TM	6.3	18.9	Ephrin type-A receptor 2 transmembrane domain
10	PF06305 LapA_dom	41	15.4	Lipopolysaccharide assembly protein A domain
11	PF00974 Rhabdo_glycop	1.4e+02	12.4	Rhabdovirus spike glycoprotein
12	PF19428 Sema4F_C	1.6e+02	13.1	Semaphorin 4F C-terminal
13	PF13908 Shisa	8.1	18.0	Wnt and FGF inhibitory regulator
14	PF13800 Sigma_reg_N	1.7e+02	13.9	Sigma factor regulator N-terminal
15	PF16311 TMEM100	2.3e+02	12.8	Transmembrane protein 100
16	PF15102 TMEM154	64	14.8	TMEM154 protein family
17	PF14979 TMEM52	1.5e+02	13.8	Transmembrane 52
18	PF00558 Vpu	27	15.9	Vpu protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379092

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000342235	0.997	Receptor tyrosine-protein kinase erbB-4
3	9606.ENSP00000269571	0.985	Receptor tyrosine-protein kinase erbB-2
4	9606.ENSP00000309968	0.956	Disintegrin and metalloproteinase domain-containing protein 17
5	9606.ENSP00000256078	0.929	GTPase KRas
6	9606.ENSP00000407586	0.926	GTPase HRas
7	9606.ENSP00000379097	0.925	Amphiregulin
8	9606.ENSP00000411898	0.919	Epigen
9	9606.ENSP00000306245	0.908	Proto-oncogene c-Fos
10	9606.ENSP00000335153	0.906	Heat shock protein HSP 90-alpha
11	9606.ENSP00000230990	0.905	Proheparin-binding EGF-like growth factor
12	9606.ENSP00000273261	0.905	Leucine-rich repeats and immunoglobulin-like domains protein 1
13	9606.ENSP00000220003	0.904	Tyrosine-protein kinase CSK
14	9606.ENSP00000357196	0.902	Receptor-type tyrosine-protein phosphatase kappa
15	9606.ENSP00000363667	0.902	Tyrosine-protein phosphatase non-receptor type 3
16	9606.ENSP00000267257	0.901	Paxillin
17	9606.ENSP00000358548	0.901	GTPase NRas
18	9606.ENSP00000426632	0.901	Erbin
19	9606.ENSP00000220597	0.900	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1
20	9606.ENSP00000222005	0.900	Hsp90 co-chaperone Cdc37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005154	1.000	epidermal growth factor receptor binding
GO:0008083	1.000	growth factor activity
GO:0030297	1.000	transmembrane receptor protein tyrosine kinase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007165	0.997	signal transduction
GO:0007169	0.987	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0048518	0.985	positive regulation of biological process
GO:0048522	0.974	positive regulation of cellular process
GO:0038127	0.974	ERBB signaling pathway
GO:0008284	0.950	positive regulation of cell population proliferation
GO:0032502	0.603	developmental process
GO:0032501	0.522	multicellular organismal process
GO:0008152	0.474	metabolic process
GO:0007173	0.426	epidermal growth factor receptor signaling pathway
GO:0019222	0.412	regulation of metabolic process
GO:0048856	0.382	anatomical structure development
GO:0030154	0.378	cell differentiation
GO:0009893	0.378	positive regulation of metabolic process
GO:0044237	0.343	cellular metabolic process
GO:0060255	0.343	regulation of macromolecule metabolic process
GO:0051128	0.330	regulation of cellular component organization
GO:0071704	0.313	organic substance metabolic process
GO:0048583	0.309	regulation of response to stimulus
GO:0048519	0.307	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0031410	0.997	cytoplasmic vesicle
GO:0031090	0.995	organelle membrane
GO:0030659	0.992	cytoplasmic vesicle membrane
GO:0098588	0.990	bounding membrane of organelle
GO:0030139	0.988	endocytic vesicle
GO:0045334	0.978	clathrin-coated endocytic vesicle
GO:0030666	0.974	endocytic vesicle membrane
GO:0005886	0.962	plasma membrane
GO:0030665	0.958	clathrin-coated vesicle membrane
GO:0030669	0.723	clathrin-coated endocytic vesicle membrane
GO:0005829	0.502	cytosol
GO:0012505	0.493	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]