StarFunc result for job id P35080

User Input

>input (140 residues)
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35080	1.000	1.000	5.210E-30	140	1.000	1.000	P35080.pdb.gz	PROF2_HUMAN Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3
2	PDB:2vk3A	0.956	0.943	2.559E-24	142	0.943	0.930	2vk3A.pdb.gz
3	AFDB:P07737	0.973	0.973	8.598E-22	140	0.614	0.614	P07737.pdb.gz	PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2
4	PDB:3chwP	0.967	0.974	2.740E-20	139	0.607	0.612	3chwP.pdb.gz	Modulation of actin structure and function by phosphorylation of Tyr-53 and profilin binding.
5	AFDB:E7F0A1	0.950	0.943	4.203E-16	141	0.336	0.333	E7F0A1.pdb.gz	E7F0A1_DANRE Profilin OS=Danio rerio OX=7955 GN=fa91a03 PE=1 SV=1
6	AFDB:Q9DAD6	0.931	0.951	1.802E-15	137	0.371	0.380	Q9DAD6.pdb.gz	PROF3_MOUSE Profilin-3 OS=Mus musculus OX=10090 GN=Pfn3 PE=1 SV=1
7	PDB:1a0kA	0.735	0.786	2.641E-8	130	0.350	0.377	1a0kA.pdb.gz
8	PDB:6b6jA	0.750	0.770	6.970E-8	136	0.329	0.338	6b6jA.pdb.gz
9	AFDB:P68696	0.749	0.824	7.370E-8	126	0.221	0.246	P68696.pdb.gz	PRO1A_ACACA Profilin-1A OS=Acanthamoeba castellanii OX=5755 PE=1 SV=2
10	AFDB:P39825	0.755	0.825	7.831E-8	127	0.264	0.291	P39825.pdb.gz	PROF_SCHPO Profilin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cdc3 PE=1 SV=1
11	PDB:1k0kA	0.705	0.779	8.361E-8	125	0.250	0.280	1k0kA.pdb.gz
12	AFDB:P07274	0.715	0.786	9.393E-8	126	0.243	0.270	P07274.pdb.gz	PROF_YEAST Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFY1 PE=1 SV=2
13	PDB:3d9yA	0.740	0.814	9.439E-8	126	0.264	0.294	3d9yA.pdb.gz
14	AFDB:Q5EF31	0.762	0.810	1.060E-7	131	0.300	0.321	Q5EF31.pdb.gz	PROF_CROSA Profilin OS=Crocus sativus OX=82528 PE=1 SV=1
15	PDB:6iqjB	0.753	0.799	1.278E-7	131	0.321	0.344	6iqjB.pdb.gz	Structural and computational examination of theArabidopsisprofilin-Poly-P complex reveals mechanistic details in profilin-regulated actin assembly.
16	PDB:7sbdC	0.750	0.775	1.629E-7	135	0.300	0.311	7sbdC.pdb.gz
17	AFDB:Q42418	0.755	0.802	1.723E-7	131	0.321	0.344	Q42418.pdb.gz	PRF2_ARATH Profilin-2 OS=Arabidopsis thaliana OX=3702 GN=PRF2 PE=1 SV=1
18	AFDB:Q8T8M2	0.734	0.806	1.723E-7	126	0.207	0.230	Q8T8M2.pdb.gz	PROF3_DICDI Profilin-3 OS=Dictyostelium discoideum OX=44689 GN=proC PE=3 SV=1
19	PDB:5fefA	0.773	0.815	2.206E-7	132	0.279	0.295	5fefA.pdb.gz
20	PDB:1prqA	0.732	0.811	1.536E-6	125	0.214	0.240	1prqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35080	1.96e-101	288	140	1.000	1.000	PROF2_HUMAN Profilin-2 OS=Homo sapiens OX=9606 GN=PFN2 PE=1 SV=3
2	Q9JJV2	3.25e-101	287	140	0.993	0.993	PROF2_MOUSE Profilin-2 OS=Mus musculus OX=10090 GN=Pfn2 PE=1 SV=3
3	Q9EPC6	3.17e-98	280	140	0.964	0.964	PROF2_RAT Profilin-2 OS=Rattus norvegicus OX=10116 GN=Pfn2 PE=1 SV=3
4	P62962	4.66e-62	188	140	0.629	0.629	PROF1_MOUSE Profilin-1 OS=Mus musculus OX=10090 GN=Pfn1 PE=1 SV=2
5	P62963	4.66e-62	188	140	0.629	0.629	PROF1_RAT Profilin-1 OS=Rattus norvegicus OX=10116 GN=Pfn1 PE=1 SV=2
6	P07737	2.49e-61	186	140	0.614	0.614	PROF1_HUMAN Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2
7	Q9DAD6	3.51e-30	107	137	0.371	0.380	PROF3_MOUSE Profilin-3 OS=Mus musculus OX=10090 GN=Pfn3 PE=1 SV=1
8	E7F0A1	5.40e-28	102	141	0.343	0.340	E7F0A1_DANRE Profilin OS=Danio rerio OX=7955 GN=fa91a03 PE=1 SV=1
9	Q8H2C9	2.16e-06	46.2	133	0.357	0.376	PROF1_ARTVU Profilin-1 OS=Artemisia vulgaris OX=4220 PE=1 SV=3
10	Q42418	8.25e-05	42.0	131	0.336	0.359	PRF2_ARATH Profilin-2 OS=Arabidopsis thaliana OX=3702 GN=PRF2 PE=1 SV=1
11	P07274	0.004	37.4	126	0.250	0.278	PROF_YEAST Profilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFY1 PE=1 SV=2
12	Q6FR43	0.010	36.2	126	0.243	0.270	Q6FR43_CANGA Profilin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=PFY1 PE=3 SV=1
13	Q5A786	0.014	35.8	126	0.179	0.198	Q5A786_CANAL Profilin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFY1 PE=3 SV=1
14	P25843	0.035	34.7	126	0.171	0.190	PROF_DROME Profilin OS=Drosophila melanogaster OX=7227 GN=chic PE=1 SV=1
15	P26200	0.095	33.5	124	0.179	0.202	PROF2_DICDI Profilin-2 OS=Dictyostelium discoideum OX=44689 GN=proB PE=1 SV=1
16	P46063	0.90	31.6	649	0.136	0.029	RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens OX=9606 GN=RECQL PE=1 SV=3
17	P26199	0.94	30.8	126	0.264	0.294	PROF1_DICDI Profilin-1 OS=Dictyostelium discoideum OX=44689 GN=proA PE=2 SV=1
18	Q26734	2.0	30.0	150	0.157	0.147	PROF_TRYBB Profilin OS=Trypanosoma brucei brucei OX=5702 PE=3 SV=1
19	B7ZMQ5	4.6	29.3	216	0.086	0.056	B7ZMQ5_MOUSE Sialic acid binding Ig-like lectin H OS=Mus musculus OX=10090 GN=Siglech PE=2 SV=1
20	Q8I218	5.4	29.3	3467	0.121	0.005	Q8I218_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0400400 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00235 Profilin	3.1e-23	93.8	Profilin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000007746

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000014874	0.928	Ena/VASP proteins are actin-associated proteins involved in a range of processes dependent on cytoskeleton remodeling and cell polarity such as axon guidance, lamellipodial and filopodial dynamics, platelet activation and cell migration.
2	60711.ENSCSAP00000010205	0.922	Dynamin 1
3	60711.ENSCSAP00000000048	0.862	Formin-like 1
4	60711.ENSCSAP00000010463	0.830	Dishevelled associated activator of morphogenesis 1
5	60711.ENSCSAP00000003164	0.788	Formin 1
6	60711.ENSCSAP00000003241	0.782	Dynamin 2
7	60711.ENSCSAP00000009191	0.778	Actin-like 6A
8	60711.ENSCSAP00000006622	0.777	Enah/Vasp-like
9	60711.ENSCSAP00000011534	0.776	WAS protein family, member 1
10	60711.ENSCSAP00000017098	0.763	Uncharacterized protein
11	60711.ENSCSAP00000007308	0.736	Dishevelled associated activator of morphogenesis 2
12	60711.ENSCSAP00000012348	0.736	ENAH, actin regulator
13	60711.ENSCSAP00000011176	0.727	Ras homolog family member A
14	60711.ENSCSAP00000003873	0.722	CAP, adenylate cyclase-associated protein, 2 (yeast)
15	60711.ENSCSAP00000003419	0.721	Actin, alpha, cardiac muscle 1
16	60711.ENSCSAP00000016874	0.710	CAP, adenylate cyclase-associated protein 1 (yeast)
17	60711.ENSCSAP00000013719	0.693	Grid2 interacting protein
18	60711.ENSCSAP00000007340	0.691	Belongs to the actin family.
19	60711.ENSCSAP00000013694	0.691	annotation not available
20	60711.ENSCSAP00000017559	0.691	Actin, beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	0.998	actin binding
GO:0003785	0.866	actin monomer binding
GO:0035091	0.825	phosphatidylinositol binding
GO:0043168	0.802	anion binding
GO:1901981	0.663	phosphatidylinositol phosphate binding
GO:0005546	0.570	phosphatidylinositol-4,5-bisphosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044087	0.991	regulation of cellular component biogenesis
GO:0110053	0.991	regulation of actin filament organization
GO:0016043	0.978	cellular component organization
GO:0032271	0.973	regulation of protein polymerization
GO:0008064	0.973	regulation of actin polymerization or depolymerization
GO:0030833	0.947	regulation of actin filament polymerization
GO:0110020	0.907	regulation of actomyosin structure organization
GO:1902905	0.904	positive regulation of supramolecular fiber organization
GO:0032231	0.892	regulation of actin filament bundle assembly
GO:0051495	0.877	positive regulation of cytoskeleton organization
GO:0051492	0.875	regulation of stress fiber assembly
GO:0032273	0.798	positive regulation of protein polymerization
GO:0030838	0.744	positive regulation of actin filament polymerization
GO:0060491	0.714	regulation of cell projection assembly
GO:0120032	0.702	regulation of plasma membrane bounded cell projection assembly
GO:0032233	0.698	positive regulation of actin filament bundle assembly
GO:0051496	0.677	positive regulation of stress fiber assembly
GO:0010632	0.667	regulation of epithelial cell migration
GO:0051129	0.577	negative regulation of cellular component organization
GO:0060255	0.521	regulation of macromolecule metabolic process
GO:0080090	0.503	regulation of primary metabolic process
GO:0051171	0.503	regulation of nitrogen compound metabolic process
GO:0031323	0.501	regulation of cellular metabolic process
GO:2000146	0.476	negative regulation of cell motility
GO:0009893	0.465	positive regulation of metabolic process
GO:0010604	0.464	positive regulation of macromolecule metabolic process
GO:0051173	0.463	positive regulation of nitrogen compound metabolic process
GO:0031325	0.463	positive regulation of cellular metabolic process
GO:0030336	0.455	negative regulation of cell migration
GO:0031345	0.437	negative regulation of cell projection organization
GO:0120033	0.423	negative regulation of plasma membrane bounded cell projection assembly
GO:0010633	0.419	negative regulation of epithelial cell migration
GO:0033138	0.411	positive regulation of peptidyl-serine phosphorylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.995	organelle
GO:0005737	0.995	cytoplasm
GO:0043227	0.992	membrane-bounded organelle
GO:0043229	0.943	intracellular organelle
GO:0005829	0.905	cytosol
GO:0005576	0.892	extracellular region
GO:0030054	0.838	cell junction
GO:0045202	0.775	synapse
GO:0031982	0.746	vesicle
GO:0005615	0.704	extracellular space
GO:1903561	0.685	extracellular vesicle
GO:0070062	0.681	extracellular exosome
GO:0043231	0.667	intracellular membrane-bounded organelle
GO:0098685	0.656	Schaffer collateral - CA1 synapse
GO:0098793	0.650	presynapse
GO:0098978	0.642	glutamatergic synapse
GO:0098794	0.607	postsynapse
GO:0005634	0.545	nucleus
GO:0071944	0.431	cell periphery
GO:0016020	0.411	membrane
GO:0043232	0.399	intracellular non-membrane-bounded organelle
GO:0120025	0.365	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]