StarFunc result for job id P35125

User Input

>input (1406 residues)
MDMVENADSLQAQERKDILMKYDKGHRAGLPEDKGPEPVGINSSIDRFGILHETELPPVT
AREAKKIRREMTRTSKWMEMLGEWETYKHSSKLIDRVYKGIPMNIRGPVWSVLLNIQEIK
LKNPGRYQIMKERGKRSSEHIHHIDLDVRTTLRNHVFFRDRYGAKQRELFYILLAYSEYN
PEVGYCRDLSHITALFLLYLPEEDAFWALVQLLASERHSLPGFHSPNGGTVQGLQDQQEH
VVPKSQPKTMWHQDKEGLCGQCASLGCLLRNLIDGISLGLTLRLWDVYLVEGEQVLMPIT
SIALKVQQKRLMKTSRCGLWARLRNQFFDTWAMNDDTVLKHLRASTKKLTRKQGDLPPPA
KREQGSLAPRPVPASRGGKTLCKGYRQAPPGPPAQFQRPICSASPPWASRFSTPCPGGAV
REDTYPVGTQGVPSLALAQGGPQGSWRFLEWKSMPRLPTDLDIGGPWFPHYDFEWSCWVR
AISQEDQLATCWQAEHCGEVHNKDMSWPEEMSFTANSSKIDRQKVPTEKGATGLSNLGNT
CFMNSSIQCVSNTQPLTQYFISGRHLYELNRTNPIGMKGHMAKCYGDLVQELWSGTQKSV
APLKLRRTIAKYAPKFDGFQQQDSQELLAFLLDGLHEDLNRVHEKPYVELKDSDGRPDWE
VAAEAWDNHLRRNRSIIVDLFHGQLRSQVKCKTCGHISVRFDPFNFLSLPLPMDSYMDLE
ITVIKLDGTTPVRYGLRLNMDEKYTGLKKQLRDLCGLNSEQILLAEVHDSNIKNFPQDNQ
KVQLSVSGFLCAFEIPVPSSPISASSPTQIDFSSSPSTNGMFTLTTNGDLPKPIFIPNGM
PNTVVPCGTEKNFTNGMVNGHMPSLPDSPFTGYIIAVHRKMMRTELYFLSPQENRPSLFG
MPLIVPCTVHTRKKDLYDAVWIQVSWLARPLPPQEASIHAQDRDNCMGYQYPFTLRVVQK
DGNSCAWCPQYRFCRGCKIDCGEDRAFIGNAYIAVDWHPTALHLRYQTSQERVVDKHESV
EQSRRAQAEPINLDSCLRAFTSEEELGESEMYYCSKCKTHCLATKKLDLWRLPPFLIIHL
KRFQFVNDQWIKSQKIVRFLRESFDPSAFLVPRDPALCQHKPLTPQGDELSKPRILAREV
KKVDAQSSAGKEDMLLSKSPSSLSANISSSPKGSPSSSRKSGTSCPSSKNSSPNSSPRTL
GRSKGRLRLPQIGSKNKPSSSKKNLDASKENGAGQICELADALSRGHMRGGSQPELVTPQ
DHEVALANGFLYEHEACGNGCGDGYSNGQLGNHSEEDSTDDQREDTHIKPIYNLYAISCH
SGILSGGHYITYAKNPNCKWYCYNDSSCEELHPDEIDTDSAYILFYEQQGIDYAQFLPKI
DGKKMADTSSTDEDSESDYEKYSMLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35125	1.000	1.000	0.000	1406	1.000	1.000	P35125.pdb.gz	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2
2	AFDB:A1LPW7	0.363	0.517	1.042E-55	963	0.158	0.231	A1LPW7.pdb.gz
3	AFDB:A0A024R2X6	0.358	0.533	4.064E-55	916	0.161	0.248	A0A024R2X6.pdb.gz
4	AFDB:P51784	0.370	0.528	6.727E-55	963	0.164	0.239	P51784.pdb.gz	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
5	AFDB:Q8R5H1	0.355	0.496	1.938E-54	981	0.165	0.236	Q8R5H1.pdb.gz	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
6	AFDB:Q9R085	0.363	0.522	3.549E-54	952	0.159	0.235	Q9R085.pdb.gz	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
7	AFDB:E7EZD6	0.325	0.446	8.791E-54	1009	0.160	0.223	E7EZD6.pdb.gz	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
8	AFDB:Q5D006	0.359	0.530	3.662E-52	921	0.155	0.237	Q5D006.pdb.gz	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
9	AFDB:O94966	0.279	0.295	1.418E-45	1318	0.161	0.172	O94966.pdb.gz	UBP19_HUMAN Ubiquitin carboxyl-terminal hydrolase 19 OS=Homo sapiens OX=9606 GN=USP19 PE=1 SV=2
10	AFDB:O60079	0.340	0.470	3.567E-44	979	0.134	0.192	O60079.pdb.gz	UBP12_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp12 PE=1 SV=1
11	PDB:3mhsA	0.199	0.575	5.498E-12	455	0.063	0.193	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
12	PDB:5cvnB	0.184	0.742	1.666E-11	321	0.061	0.268	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:5k16B	0.176	0.706	6.274E-10	328	0.062	0.265	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:3ihpB	0.189	0.375	2.748E-8	681	0.070	0.145	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
15	PDB:4fjcE	0.173	0.515	5.565E-8	434	0.063	0.205	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
16	PDB:4wa6D	0.182	0.581	1.774E-7	415	0.058	0.195	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
17	PDB:5k1bA	0.085	0.426	2.654E-7	264	0.032	0.170	5k1bA.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
18	PDB:7w3ax	0.185	0.492	7.648E-7	494	0.073	0.206	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
19	PDB:7ay1D	0.183	0.687	1.145E-6	341	0.055	0.229	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
20	PDB:5gjqx	0.091	0.328	1.266E-6	355	0.040	0.158	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6NER0	0.0	843	549	0.289	0.740	TBC3F_HUMAN TBC1 domain family member 3F OS=Homo sapiens OX=9606 GN=TBC1D3F PE=1 SV=3
2	K7EQL6	0.0	1701	1274	0.607	0.670	K7EQL6_HUMAN ubiquitinyl hydrolase 1 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
3	P35125	0.0	2941	1406	1.000	1.000	UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens OX=9606 GN=USP6 PE=1 SV=2
4	Q6DHY5	0.0	843	549	0.289	0.741	TBC3G_HUMAN TBC1 domain family member 3G OS=Homo sapiens OX=9606 GN=TBC1D3G PE=1 SV=2
5	Q8IZP1	0.0	842	549	0.289	0.740	TBC3A_HUMAN TBC1 domain family member 3 OS=Homo sapiens OX=9606 GN=TBC1D3 PE=1 SV=6
6	Q8NFA0	0.0	1702	1604	0.607	0.532	UBP32_HUMAN Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
7	K7EKZ1	1.03e-85	301	847	0.102	0.169	K7EKZ1_HUMAN ubiquitinyl hydrolase 1 (Fragment) OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1
8	Q92738	1.89e-75	271	828	0.110	0.186	US6NL_HUMAN USP6 N-terminal-like protein OS=Homo sapiens OX=9606 GN=USP6NL PE=1 SV=3
9	Q9Y4E8	5.53e-74	270	981	0.090	0.129	UBP15_HUMAN Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3
10	Q9R085	1.67e-73	268	952	0.097	0.144	UBP15_RAT Ubiquitin carboxyl-terminal hydrolase 15 OS=Rattus norvegicus OX=10116 GN=Usp15 PE=1 SV=1
11	Q8R5H1	4.63e-73	266	981	0.090	0.128	UBP15_MOUSE Ubiquitin carboxyl-terminal hydrolase 15 OS=Mus musculus OX=10090 GN=Usp15 PE=1 SV=1
12	Q13107	2.37e-71	261	963	0.085	0.125	UBP4_HUMAN Ubiquitin carboxyl-terminal hydrolase 4 OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=3
13	P35123	8.93e-71	259	962	0.083	0.122	UBP4_MOUSE Ubiquitin carboxyl-terminal hydrolase 4 OS=Mus musculus OX=10090 GN=Usp4 PE=1 SV=3
14	E7EZD6	8.15e-70	257	1009	0.088	0.123	E7EZD6_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=usp4 PE=1 SV=1
15	Q5D006	3.50e-69	254	921	0.085	0.129	UBP11_RAT Ubiquitin carboxyl-terminal hydrolase 11 OS=Rattus norvegicus OX=10116 GN=Usp11 PE=1 SV=1
16	G5E9A6	3.66e-69	254	920	0.090	0.138	G5E9A6_HUMAN Ubiquitin carboxyl-terminal hydrolase OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=1
17	P51784	5.28e-69	254	963	0.090	0.132	UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3
18	Q8WT44	1.39e-66	249	1178	0.135	0.161	UBPH_CAEEL Ubiquitin carboxyl-terminal hydrolase cyk-3 OS=Caenorhabditis elegans OX=6239 GN=cyk-3 PE=1 SV=1
19	O22207	2.05e-62	233	924	0.083	0.127	UBP5_ARATH Ubiquitin carboxyl-terminal hydrolase 5 OS=Arabidopsis thaliana OX=3702 GN=UBP5 PE=1 SV=2
20	H7C189	3.26e-62	227	621	0.078	0.176	H7C189_HUMAN Ubiquitin carboxyl-terminal hydrolase (Fragment) OS=Homo sapiens OX=9606 GN=USP4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00566 RabGAP-TBC	2e-34	130.7	Rab-GTPase-TBC domain
2	PF00443 UCH	1.4e-92	321.8	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	9.9e-08	43.6	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000460380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219476	0.985	Tuberin
2	9606.ENSP00000298316	0.979	ADP-ribosylation factor 6
3	9606.ENSP00000353549	0.892	Cell division cycle protein 16 homolog
4	9606.ENSP00000261601	0.843	Ubiquitin carboxyl-terminal hydrolase 14
5	9606.ENSP00000346139	0.806	TBC1 domain family member 20
6	9606.ENSP00000250237	0.769	Queuine tRNA-ribosyltransferase catalytic subunit 1
7	9606.ENSP00000475727	0.759	TBC1 domain family member 7
8	9606.ENSP00000348708	0.730	Regulator of nonsense transcripts 2
9	9606.ENSP00000365962	0.658	TBC1 domain family member 25
10	9606.ENSP00000448182	0.653	TBC1 domain family member 15
11	9606.ENSP00000383118	0.638	Cell division control protein 42 homolog
12	9606.ENSP00000343535	0.637	Ubiquitin carboxyl-terminal hydrolase 7
13	9606.ENSP00000285420	0.626	[Isoform 1]: Deubiquitinating enzyme that may play a role in the ubiquitin-dependent regulation of protein synthesis, downstream of mTORC1 . May associate with the protein synthesis initiation complex and modify its ubiquitination to repress translation . May also repress DNA synthesis and modify different cellular targets thereby regulating cell growth and proliferation . May also play a role in proteasome assembly and function
14	9606.ENSP00000377700	0.626	TBC1 domain family member 23
15	9606.ENSP00000349437	0.600	Cation-independent mannose-6-phosphate receptor
16	9606.ENSP00000350512	0.582	COP9 signalosome complex subunit 5
17	9606.ENSP00000402935	0.580	TBC1 domain family member 5
18	9606.ENSP00000003302	0.576	Ubiquitin carboxyl-terminal hydrolase 28
19	9606.ENSP00000293970	0.573	TBC1 domain family member 24
20	9606.ENSP00000264710	0.572	Ras-related protein Rab-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004197	1.000	cysteine-type endopeptidase activity
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0003676	0.996	nucleic acid binding
GO:0019899	0.425	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0016579	0.987	protein deubiquitination
GO:0032879	0.914	regulation of localization
GO:0051049	0.891	regulation of transport
GO:0060627	0.878	regulation of vesicle-mediated transport
GO:0009987	0.597	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0016020	0.999	membrane
GO:0012505	0.998	endomembrane system
GO:0005886	0.992	plasma membrane
GO:0031410	0.985	cytoplasmic vesicle
GO:0005829	0.972	cytosol
GO:0005768	0.924	endosome
GO:0005773	0.787	vacuole
GO:0000323	0.742	lytic vacuole
GO:0005764	0.731	lysosome
GO:0055037	0.696	recycling endosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.22.-	1.000	Cysteine endopeptidases.
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]