StarFunc result for job id P35222

User Input

>input (781 residues)
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTS
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8Y5A3	0.771	0.769	3.642E-79	783	0.999	0.996	A0A2R8Y5A3.pdb.gz	A0A2R8Y5A3_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
2	AFDB:A0A2R8Y5Z1	0.738	0.766	3.547E-74	752	0.956	0.993	A0A2R8Y5Z1.pdb.gz	A0A2R8Y5Z1_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
3	AFDB:A0A2R8Y750	0.764	0.801	4.309E-73	744	0.948	0.995	A0A2R8Y750.pdb.gz	A0A2R8Y750_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
4	AFDB:P18824	0.756	0.702	5.820E-61	843	0.686	0.636	P18824.pdb.gz	ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1
5	PDB:2z6gA	0.695	0.984	1.276E-55	550	0.695	0.987	2z6gA.pdb.gz
6	AFDB:P14923	0.720	0.754	1.653E-55	745	0.648	0.679	P14923.pdb.gz	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
7	AFDB:A0A2R8QDB8	0.724	0.773	4.651E-55	729	0.611	0.654	A0A2R8QDB8.pdb.gz
8	AFDB:Q7ZWH9	0.310	0.614	4.936E-27	390	0.355	0.710	Q7ZWH9.pdb.gz
9	AFDB:H2L2I2	0.581	0.639	5.900E-27	704	0.277	0.307	H2L2I2.pdb.gz	H2L2I2_CAEEL Armadillo/beta-catenin-like repeat protein OS=Caenorhabditis elegans OX=6239 GN=hmp-2 PE=1 SV=1
10	PDB:4r0zA	0.549	0.749	1.581E-24	557	0.245	0.343	4r0zA.pdb.gz
11	AFDB:Q5T2S8	0.414	0.326	1.544E-15	1044	0.159	0.119	Q5T2S8.pdb.gz	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
12	AFDB:E1B8W3	0.430	0.331	1.719E-15	1044	0.145	0.108	E1B8W3.pdb.gz	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
13	PDB:7rroH7	0.397	0.498	3.854E-13	580	0.143	0.193	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:6kbnC	0.450	0.652	7.184E-12	504	0.111	0.173	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
15	PDB:1wa5B	0.340	0.519	3.904E-10	466	0.106	0.178	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
16	PDB:3tpoA	0.415	0.693	1.313E-9	438	0.106	0.189	3tpoA.pdb.gz
17	PDB:5tbkA	0.345	0.575	1.569E-9	417	0.083	0.156	5tbkA.pdb.gz
18	PDB:4tnmA	0.398	0.712	2.982E-9	407	0.093	0.179	4tnmA.pdb.gz
19	PDB:4jlqA	0.370	0.347	1.334E-8	840	0.101	0.094	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
20	PDB:7nscE	0.380	0.461	1.775E-8	615	0.092	0.117	7nscE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D5NYE8	1613	781	0.997	0.997	A0A1D5NYE8_CHICK Catenin beta 1 OS=Gallus gallus OX=9031 GN=CTNNB1 PE=1 SV=1
2	A0A2R8Y5A3	1609	783	0.999	0.996	A0A2R8Y5A3_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
3	A0A2R8Y5C3	1507	737	0.944	1.000	A0A2R8Y5C3_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
4	A0A2R8Y5Z1	1544	752	0.963	1.000	A0A2R8Y5Z1_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
5	A0A2R8Y750	1521	744	0.953	1.000	A0A2R8Y750_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
6	A0A2R8Y7Z0	1610	780	0.999	1.000	A0A2R8Y7Z0_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
7	A0A2R8Y804	1423	702	0.886	0.986	A0A2R8Y804_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
8	A0A2R8YCH5	1612	779	0.997	1.000	A0A2R8YCH5_HUMAN Catenin beta 1 (Fragment) OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
9	A1A5I6	1571	780	0.972	0.973	A1A5I6_XENLA Catenin beta 1 S homeolog isoform X2 OS=Xenopus laevis OX=8355 GN=ctnnb1.S PE=2 SV=1
10	B4DGU4	1603	774	0.991	1.000	B4DGU4_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
11	B6V8E6	1616	781	0.999	0.999	CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris OX=9615 GN=CTNNB1 PE=1 SV=1
12	F1QGH7	1581	780	0.974	0.976	CTNB1_DANRE Catenin beta-1 OS=Danio rerio OX=7955 GN=ctnnb1 PE=1 SV=1
13	O42486	1606	781	0.994	0.994	O42486_CHICK Beta catenin OS=Gallus gallus OX=9031 GN=Bcat PE=1 SV=1
14	P14923	987	745	0.652	0.683	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
15	P18824	1059	843	0.703	0.651	ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1
16	P26233	1584	781	0.974	0.974	CTNB1_XENLA Catenin beta-1 OS=Xenopus laevis OX=8355 GN=ctnnb1 PE=1 SV=1
17	P35222	1617	781	1.000	1.000	CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
18	Q02248	1615	781	0.999	0.999	CTNB1_MOUSE Catenin beta-1 OS=Mus musculus OX=10090 GN=Ctnnb1 PE=1 SV=1
19	Q02257	984	745	0.650	0.682	PLAK_MOUSE Junction plakoglobin OS=Mus musculus OX=10090 GN=Jup PE=1 SV=3
20	Q0VCX4	1616	781	0.999	0.999	CTNB1_BOVIN Catenin beta-1 OS=Bos taurus OX=9913 GN=CTNNB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	0.0051	27.1	Adaptin N terminal region
2	PF00514 Arm	1.8e-40	147.0	Armadillo/beta-catenin-like repeat
3	PF04826 Arm_2	49	14.9	Armadillo-like
4	PF09759 Atx10homo_assoc	35	15.8	Spinocerebellar ataxia type 10 protein domain
5	PF12717 Cnd1	0.00025	32.6	non-SMC mitotic condensation complex subunit 1
6	PF11841 ELMO_ARM	9.3	17.6	ELMO, armadillo-like helical domain
7	PF02985 HEAT	0.0047	28.1	HEAT repeat
8	PF13646 HEAT_2	0.0037	29.0	HEAT repeats
9	PF13513 HEAT_EZ	0.1	24.5	HEAT-like repeat
10	PF05804 KAP	0.47	20.2	Kinesin-associated protein (KAP)
11	PF05396 Phage_T7_Capsid	2.3e+02	13.3	Phage T7 capsid assembly protein
12	PF02547 Queuosine_synth	82	13.8	Queuosine biosynthesis protein
13	PF14663 RasGEF_N_2	7.1	18.5	Rapamycin-insensitive companion of mTOR RasGEF_N domain
14	PF07814 WAPL	27	15.0	Wings apart-like protein regulation of heterochromatin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 482537.XP_008583518.1

Rank	PPI partner	STRING score	Description
1	482537.XP_008565279.1	0.999	Cadherin-1
2	482537.XP_008566086.1	0.999	Beta-catenin-interacting protein 1
3	482537.XP_008566398.1	0.999	Adenomatous polyposis coli protein isoform X1
4	482537.XP_008567763.1	0.999	Cadherin-2
5	482537.XP_008569226.1	0.999	Transcription factor 7-like 2 isoform X1
6	482537.XP_008575019.1	0.999	Lymphoid enhancer-binding factor 1 isoform X1
7	482537.XP_008576551.1	0.999	CREB-binding protein isoform X1
8	482537.XP_008577002.1	0.999	Glycogen synthase kinase-3 beta isoform X1
9	482537.XP_008580219.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 9 mRNAs, 24 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
10	482537.XP_008584871.1	0.999	B-cell CLL/lymphoma 9 protein
11	482537.XP_008584997.1	0.999	Catenin alpha-1 isoform X1
12	482537.XP_008587593.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 10 Proteins, and 83% coverage of the annotated genomic feature by RNAseq alignments
13	482537.XP_008563573.1	0.998	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 mRNAs, 24 Proteins, and 98% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
14	482537.XP_008565972.1	0.997	Cadherin-3
15	482537.XP_008582108.1	0.997	Presenilin-1 isoform X1
16	482537.XP_008578140.1	0.996	Catenin delta-1 isoform X1
17	482537.XP_008579535.1	0.996	Axin-2 isoform X1
18	482537.XP_008579122.1	0.994	Androgen receptor
19	482537.XP_008580551.1	0.994	ruvB-like 1
20	482537.XP_008563884.1	0.992	Transcription factor 4-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0050839	0.975	cell adhesion molecule binding
GO:0045296	0.952	cadherin binding
GO:0019899	0.347	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.985	response to stimulus
GO:0050789	0.985	regulation of biological process
GO:0050794	0.983	regulation of cellular process
GO:0051716	0.979	cellular response to stimulus
GO:0007154	0.978	cell communication
GO:0032502	0.969	developmental process
GO:0060255	0.968	regulation of macromolecule metabolic process
GO:0048518	0.967	positive regulation of biological process
GO:0048856	0.953	anatomical structure development
GO:0032501	0.943	multicellular organismal process
GO:0051171	0.941	regulation of nitrogen compound metabolic process
GO:0198738	0.927	cell-cell signaling by wnt
GO:0010468	0.922	regulation of gene expression
GO:0007275	0.913	multicellular organism development
GO:0031323	0.911	regulation of cellular metabolic process
GO:0060070	0.894	canonical Wnt signaling pathway
GO:0009888	0.875	tissue development
GO:0048519	0.852	negative regulation of biological process
GO:0051239	0.840	regulation of multicellular organismal process
GO:0071840	0.833	cellular component organization or biogenesis
GO:0080090	0.828	regulation of primary metabolic process
GO:0016043	0.821	cellular component organization
GO:0048731	0.821	system development
GO:0009653	0.813	anatomical structure morphogenesis
GO:0048522	0.812	positive regulation of cellular process
GO:0048513	0.794	animal organ development
GO:0009889	0.772	regulation of biosynthetic process
GO:0045597	0.760	positive regulation of cell differentiation
GO:0009893	0.747	positive regulation of metabolic process
GO:0010604	0.744	positive regulation of macromolecule metabolic process
GO:0010628	0.731	positive regulation of gene expression
GO:0035136	0.705	forelimb morphogenesis
GO:0030154	0.665	cell differentiation
GO:0048523	0.665	negative regulation of cellular process
GO:0030326	0.651	embryonic limb morphogenesis
GO:0009887	0.619	animal organ morphogenesis
GO:0051240	0.611	positive regulation of multicellular organismal process
GO:0007155	0.560	cell adhesion
GO:0051173	0.517	positive regulation of nitrogen compound metabolic process
GO:0009953	0.513	dorsal/ventral pattern formation
GO:0010556	0.502	regulation of macromolecule biosynthetic process
GO:0048583	0.490	regulation of response to stimulus
GO:0031326	0.488	regulation of cellular biosynthetic process
GO:0009798	0.485	axis specification
GO:0010646	0.479	regulation of cell communication
GO:2001141	0.476	regulation of RNA biosynthetic process
GO:1903506	0.471	regulation of nucleic acid-templated transcription
GO:0006355	0.464	regulation of DNA-templated transcription
GO:0009966	0.458	regulation of signal transduction
GO:0031325	0.449	positive regulation of cellular metabolic process
GO:0071704	0.411	organic substance metabolic process
GO:0002009	0.357	morphogenesis of an epithelium
GO:0010717	0.333	regulation of epithelial to mesenchymal transition
GO:0042221	0.314	response to chemical
GO:0065009	0.312	regulation of molecular function
GO:0010718	0.311	positive regulation of epithelial to mesenchymal transition
GO:0045935	0.300	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043231	0.963	intracellular membrane-bounded organelle
GO:0005634	0.898	nucleus
GO:0005737	0.806	cytoplasm
GO:0005829	0.622	cytosol
GO:0043233	0.314	organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]