StarFunc result for job id P35227

User Input

>input (344 residues)
MHRTTRIKITELNPHLMCALCGGYFIDATTIVECLHSFCKTCIVRYLETNKYCPMCDVQV
HKTRPLLSIRSDKTLQDIVYKLVPGLFKDEMKRRRDFYAAYPLTEVPNGSNEDRGEVLEQ
EKGALSDDEIVSLSIEFYEGARDRDEKKGPLENGDGDKEKTGVRFLRCPAAMTVMHLAKF
LRNKMDVPSKYKVEVLYEDEPLKEYYTLMDIAYIYPWRRNGPLPLKYRVQPACKRLTLAT
VPTPSEGTNTSGASECESVSDKAPSPATLPATSSSLPSPATPSHGSPSSHGPPATHPTSP
TPPSTASGATTAANGGSLNCLQTPSSTSRGRKMTVNGAPVPPLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1V6	0.659	0.659	3.343E-61	344	1.000	1.000	A0A024R1V6.pdb.gz
2	AFDB:Q8JIR0	0.527	0.561	1.027E-43	320	0.605	0.650	Q8JIR0.pdb.gz	BMI1A_DANRE Polycomb complex protein BMI-1-A OS=Danio rerio OX=7955 GN=bmi1a PE=1 SV=2
3	AFDB:Q7T3E6	0.527	0.552	4.783E-43	324	0.590	0.627	Q7T3E6.pdb.gz	BMI1B_DANRE Polycomb complex protein BMI-1-B OS=Danio rerio OX=7955 GN=bmi1b PE=2 SV=1
4	AFDB:R4GMX3	0.561	0.428	6.591E-43	469	0.613	0.450	R4GMX3.pdb.gz	R4GMX3_HUMAN COMMD3-BMI1 readthrough OS=Homo sapiens OX=9606 GN=COMMD3-BMI1 PE=4 SV=1
5	AFDB:Q8R023	0.320	0.416	1.502E-21	259	0.276	0.367	Q8R023.pdb.gz	PCGF1_MOUSE Polycomb group RING finger protein 1 OS=Mus musculus OX=10090 GN=Pcgf1 PE=2 SV=2
6	AFDB:Q7ZYZ7	0.365	0.463	2.070E-21	261	0.259	0.341	Q7ZYZ7.pdb.gz	PCGF1_DANRE Polycomb group RING finger protein 1 OS=Danio rerio OX=7955 GN=pcgf1 PE=3 SV=1
7	AFDB:Q99NA9	0.287	0.280	2.354E-21	353	0.241	0.235	Q99NA9.pdb.gz	PCGF6_MOUSE Polycomb group RING finger protein 6 OS=Mus musculus OX=10090 GN=Pcgf6 PE=1 SV=1
8	AFDB:Q3KNV8	0.302	0.426	1.247E-20	242	0.250	0.355	Q3KNV8.pdb.gz	PCGF3_HUMAN Polycomb group RING finger protein 3 OS=Homo sapiens OX=9606 GN=PCGF3 PE=1 SV=1
9	AFDB:Q3UK78	0.317	0.414	1.247E-20	256	0.230	0.309	Q3UK78.pdb.gz	PCGF5_MOUSE Polycomb group RING finger protein 5 OS=Mus musculus OX=10090 GN=Pcgf5 PE=1 SV=1
10	AFDB:Q5T8Z2	0.260	0.463	6.603E-20	184	0.358	0.668	Q5T8Z2.pdb.gz	Q5T8Z2_HUMAN BMI1 proto-oncogene, polycomb ring finger (Fragment) OS=Homo sapiens OX=9606 GN=BMI1 PE=4 SV=1
11	PDB:4r8pL	0.230	0.308	2.684E-6	254	0.078	0.106	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
12	PDB:7yo8A	0.215	0.499	2.374E-5	140	0.055	0.136	7yo8A.pdb.gz
13	PDB:5k1aF	0.204	0.121	5.125E-5	600	0.047	0.027	5k1aF.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:3h9dA	0.206	0.561	7.062E-5	116	0.061	0.181	3h9dA.pdb.gz	Trypanosoma brucei ATG8: structural insights into autophagic-like mechanisms in protozoa.
15	PDB:5azhA	0.213	0.535	1.970E-4	127	0.070	0.189	5azhA.pdb.gz
16	PDB:6aafA	0.194	0.540	2.388E-4	112	0.044	0.134	6aafA.pdb.gz	Lipidation-independent vacuolar functions of Atg8 rely on its noncanonical interaction with a vacuole membrane protein
17	PDB:7brnA	0.216	0.535	2.714E-4	133	0.052	0.135	7brnA.pdb.gz	Super-assembly of ER-phagy receptor Atg40 induces local ER remodeling at contacts with forming autophagosomal membranes.
18	PDB:6mdhA	0.195	0.417	2.894E-4	149	0.029	0.067	6mdhA.pdb.gz
19	PDB:7aa8C	0.202	0.497	4.834E-4	133	0.052	0.135	7aa8C.pdb.gz
20	PDB:5l83B	0.203	0.585	6.661E-4	112	0.047	0.143	5l83B.pdb.gz	Structural Basis of Host Autophagy-related Protein 8 (ATG8) Binding by the Irish Potato Famine Pathogen Effector Protein PexRD54.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P23798	0.0	657	342	0.953	0.959	PCGF2_MOUSE Polycomb group RING finger protein 2 OS=Mus musculus OX=10090 GN=Pcgf2 PE=1 SV=2
2	P35227	0.0	709	344	1.000	1.000	PCGF2_HUMAN Polycomb group RING finger protein 2 OS=Homo sapiens OX=9606 GN=PCGF2 PE=1 SV=1
3	P35226	2.29e-150	427	326	0.616	0.650	BMI1_HUMAN Polycomb complex protein BMI-1 OS=Homo sapiens OX=9606 GN=BMI1 PE=1 SV=2
4	P25916	1.82e-149	425	324	0.625	0.664	BMI1_MOUSE Polycomb complex protein BMI-1 OS=Mus musculus OX=10090 GN=Bmi1 PE=1 SV=1
5	R4GMX3	3.96e-149	430	469	0.616	0.452	R4GMX3_HUMAN COMMD3-BMI1 readthrough OS=Homo sapiens OX=9606 GN=COMMD3-BMI1 PE=4 SV=1
6	Q8JIR0	3.22e-141	404	320	0.610	0.656	BMI1A_DANRE Polycomb complex protein BMI-1-A OS=Danio rerio OX=7955 GN=bmi1a PE=1 SV=2
7	Q7T3E6	3.00e-135	389	324	0.596	0.633	BMI1B_DANRE Polycomb complex protein BMI-1-B OS=Danio rerio OX=7955 GN=bmi1b PE=2 SV=1
8	P35820	6.16e-52	187	1601	0.270	0.058	PSC_DROME Polycomb group protein Psc OS=Drosophila melanogaster OX=7227 GN=Psc PE=1 SV=2
9	Q7ZYZ7	4.04e-51	172	261	0.262	0.345	PCGF1_DANRE Polycomb group RING finger protein 1 OS=Danio rerio OX=7955 GN=pcgf1 PE=3 SV=1
10	Q6DLV9	3.62e-50	169	243	0.267	0.379	PCGF1_RAT Polycomb group RING finger protein 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Pcgf1 PE=2 SV=1
11	Q5T8Z2	1.51e-49	166	184	0.238	0.446	Q5T8Z2_HUMAN BMI1 proto-oncogene, polycomb ring finger (Fragment) OS=Homo sapiens OX=9606 GN=BMI1 PE=4 SV=1
12	Q8R023	3.34e-49	167	259	0.259	0.344	PCGF1_MOUSE Polycomb group RING finger protein 1 OS=Mus musculus OX=10090 GN=Pcgf1 PE=2 SV=2
13	Q9BSM1	1.49e-48	166	259	0.256	0.340	PCGF1_HUMAN Polycomb group RING finger protein 1 OS=Homo sapiens OX=9606 GN=PCGF1 PE=1 SV=2
14	Q8BTQ0	2.53e-45	157	241	0.259	0.369	PCGF3_MOUSE Polycomb group RING finger protein 3 OS=Mus musculus OX=10090 GN=PcgF3 PE=1 SV=1
15	Q3KNV8	7.49e-45	155	242	0.250	0.355	PCGF3_HUMAN Polycomb group RING finger protein 3 OS=Homo sapiens OX=9606 GN=PCGF3 PE=1 SV=1
16	Q9BYE7	1.31e-39	145	350	0.241	0.237	PCGF6_HUMAN Polycomb group RING finger protein 6 OS=Homo sapiens OX=9606 GN=PCGF6 PE=1 SV=2
17	Q99NA9	2.35e-38	141	353	0.247	0.241	PCGF6_MOUSE Polycomb group RING finger protein 6 OS=Mus musculus OX=10090 GN=Pcgf6 PE=1 SV=1
18	P25172	5.84e-34	134	1368	0.212	0.053	SUZ2_DROME Protein suppressor 2 of zeste OS=Drosophila melanogaster OX=7227 GN=Su(z)2 PE=2 SV=2
19	Q3UK78	1.13e-32	124	256	0.209	0.281	PCGF5_MOUSE Polycomb group RING finger protein 5 OS=Mus musculus OX=10090 GN=Pcgf5 PE=1 SV=1
20	Q86SE9	4.45e-30	117	256	0.215	0.289	PCGF5_HUMAN Polycomb group RING finger protein 5 OS=Homo sapiens OX=9606 GN=PCGF5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	7.9e+02	11.3	Prokaryotic RING finger family 4
2	PF11976 Rad60-SLD	3.9e+02	12.3	Ubiquitin-2 like Rad60 SUMO-like
3	PF16207 RAWUL	4.2e-16	70.6	RAWUL domain RING finger- and WD40-associated ubiquitin-like
4	PF12861 zf-ANAPC11	2.3e+02	13.2	Anaphase-promoting complex subunit 11 RING-H2 finger
5	PF00097 zf-C3HC4	2.6e-06	38.5	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	3.5e-07	41.3	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.015	26.5	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	1.3e+02	14.1	zinc finger of C3HC4-type, RING
9	PF11789 zf-Nse	1.2e+02	14.0	Zinc-finger of the MIZ type in Nse subunit
10	PF12678 zf-rbx1	0.046	25.3	RING-H2 zinc finger domain
11	PF16685 zf-RING_10	2.8e+02	13.0	zinc RING finger of MSL2
12	PF13639 zf-RING_2	0.002	29.8	Ring finger domain
13	PF14634 zf-RING_5	0.62	21.4	zinc-RING finger domain
14	PF13445 zf-RING_UBOX	2.7	19.4	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000482063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000440674	0.998	Polyhomeotic-like protein 1
2	9606.ENSP00000257118	0.996	Polyhomeotic-like protein 2
3	9606.ENSP00000269385	0.996	Chromobox protein homolog 8
4	9606.ENSP00000308750	0.996	Chromobox protein homolog 2
5	9606.ENSP00000356480	0.995	E3 ubiquitin-protein ligase RING2
6	9606.ENSP00000216133	0.994	Chromobox protein homolog 7
7	9606.ENSP00000363787	0.994	E3 ubiquitin-protein ligase RING1
8	9606.ENSP00000420294	0.994	Polyhomeotic-like protein 3
9	9606.ENSP00000269397	0.993	E3 SUMO-protein ligase CBX4
10	9606.ENSP00000384490	0.986	Chromobox protein homolog 6
11	9606.ENSP00000419494	0.986	RING1 and YY1-binding protein
12	9606.ENSP00000318094	0.985	Polycomb protein SCMH1
13	9606.ENSP00000348056	0.984	SUMO-conjugating enzyme UBC9
14	9606.ENSP00000365851	0.974	Polycomb complex protein BMI-1
15	9606.ENSP00000263360	0.968	Polycomb protein EED
16	9606.ENSP00000320147	0.968	Histone-lysine N-methyltransferase EZH2
17	9606.ENSP00000251900	0.962	Sex comb on midleg-like protein 2
18	9606.ENSP00000316578	0.962	Polycomb protein SUZ12
19	9606.ENSP00000404658	0.951	Histone-lysine N-methyltransferase EZH1
20	9606.ENSP00000369424	0.941	Histone-binding protein RBBP7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.730	chromatin binding
GO:0140096	0.396	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0044238	0.996	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0048519	0.996	negative regulation of biological process
GO:0043170	0.996	macromolecule metabolic process
GO:0080090	0.995	regulation of primary metabolic process
GO:0051171	0.995	regulation of nitrogen compound metabolic process
GO:0016570	0.990	histone modification
GO:0048523	0.987	negative regulation of cellular process
GO:0006355	0.986	regulation of DNA-templated transcription
GO:0045892	0.975	negative regulation of DNA-templated transcription
GO:0006357	0.966	regulation of transcription by RNA polymerase II
GO:0016567	0.945	protein ubiquitination
GO:0000122	0.934	negative regulation of transcription by RNA polymerase II
GO:0016574	0.892	histone ubiquitination
GO:0009987	0.882	cellular process
GO:0050896	0.379	response to stimulus
GO:0048518	0.375	positive regulation of biological process
GO:0032502	0.323	developmental process
GO:0048522	0.320	positive regulation of cellular process
GO:0009893	0.302	positive regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0031519	0.997	PcG protein complex
GO:0005694	0.992	chromosome
GO:0000785	0.967	chromatin
GO:1990234	0.952	transferase complex
GO:0000151	0.935	ubiquitin ligase complex
GO:0000152	0.933	nuclear ubiquitin ligase complex
GO:0016604	0.610	nuclear body
GO:0005737	0.440	cytoplasm
GO:0035102	0.300	PRC1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]