StarFunc result for job id P35228

User Input

>input (1153 residues)
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRREIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDKYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGQGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEEPERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHAVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
VAVQPSSLEMSAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0R4IQG7	0.452	0.370	0.000	1431	0.526	0.424	A0A0R4IQG7.pdb.gz	A0A0R4IQG7_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=nNOS PE=1 SV=1
2	AFDB:A2BIN8	0.552	0.584	0.000	1079	0.545	0.582	A2BIN8.pdb.gz	A2BIN8_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosa PE=3 SV=1
3	AFDB:A9JNR5	0.527	0.559	0.000	1077	0.548	0.587	A9JNR5.pdb.gz	A9JNR5_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=2 SV=1
4	AFDB:P29475	0.447	0.365	0.000	1434	0.537	0.432	P29475.pdb.gz	NOS1_HUMAN Nitric oxide synthase 1 OS=Homo sapiens OX=9606 GN=NOS1 PE=1 SV=2
5	AFDB:P35228	1.000	1.000	0.000	1153	1.000	1.000	P35228.pdb.gz	NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2 PE=1 SV=2
6	AFDB:Q06518	0.946	0.951	0.000	1147	0.803	0.807	Q06518.pdb.gz	NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus OX=10116 GN=Nos2 PE=1 SV=2
7	AFDB:Q27571	0.446	0.386	0.000	1349	0.448	0.383	Q27571.pdb.gz	NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster OX=7227 GN=Nos PE=1 SV=3
8	AFDB:Q6Y5E2	0.452	0.432	0.000	1209	0.506	0.482	Q6Y5E2.pdb.gz	Q6Y5E2_RABIT Nitric oxide synthase OS=Oryctolagus cuniculus OX=9986 PE=2 SV=1
9	AFDB:Q90WQ9	0.560	0.583	0.000	1100	0.552	0.578	Q90WQ9.pdb.gz	Q90WQ9_ONCMY Nitric oxide synthase OS=Oncorhynchus mykiss OX=8022 GN=NOS2 PE=3 SV=1
10	AFDB:Q156E2	0.371	0.559	5.943E-75	761	0.290	0.439	Q156E2.pdb.gz	Q156E2_ONCMY nitric-oxide synthase (NADPH) (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
11	PDB:6j79A	0.379	0.519	7.905E-51	816	0.180	0.254	6j79A.pdb.gz	Crystal structure of a NADPH-cytochrome P450 oxidoreductase (CYPOR) and heme oxygenase 1 fusion protein implies a conformational change in CYPOR upon NADPH/NADP+binding.
12	PDB:5gxuA	0.345	0.684	5.660E-47	552	0.160	0.333	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
13	PDB:4d3iA	0.305	0.956	7.402E-42	363	0.133	0.421	4d3iA.pdb.gz	Structure-Based Design of Bacterial Nitric Oxide Synthase Inhibitors.
14	PDB:2bf4A	0.383	0.648	3.030E-40	645	0.143	0.256	2bf4A.pdb.gz	A Second Fmn-Binding Site in Yeast Nadph-Cytochrome P450 Reductase Suggests a Mechanism of Electron Transfer by Diflavin Reductases.
15	PDB:7suzA	0.312	0.894	9.995E-34	389	0.117	0.347	7suzA.pdb.gz	Functional and structural insight into the flexibility of cytochrome P450 reductases from Sorghum bicolor and its implications for lignin composition.
16	PDB:3lvbA	0.222	0.786	1.943E-16	311	0.076	0.283	3lvbA.pdb.gz	Biochemical and crystallographic characterization of ferredoxin-NADP(+) reductase from nonphotosynthetic tissues
17	PDB:1gvhA	0.165	0.435	2.233E-8	396	0.061	0.177	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
18	PDB:2m6sA	0.117	0.818	2.624E-8	149	0.034	0.262	2m6sA.pdb.gz	1H, 13C and 15N resonance assignments of the apo and holo states of flavodoxin YqcA from Escherichia coli.
19	PDB:4oxxA	0.120	0.839	3.083E-8	153	0.034	0.255	4oxxA.pdb.gz	Crystal structure of cindoxin, the P450cin redox partner.
20	PDB:7xk3F	0.183	0.481	3.823E-8	408	0.054	0.152	7xk3F.pdb.gz	Cryo-EM structures of Na + -pumping NADH-ubiquinone oxidoreductase from Vibrio cholerae.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060XV60	1369	1083	0.554	0.590	A0A060XV60_ONCMY Nitric oxide synthase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00018385001 PE=3 SV=1
2	A0A0R4IQG7	1235	1431	0.535	0.431	A0A0R4IQG7_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=nNOS PE=1 SV=1
3	A2BIN8	1348	1079	0.547	0.585	A2BIN8_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosa PE=3 SV=1
4	A7WK81	1348	1079	0.546	0.584	A7WK81_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=NOS2 PE=2 SV=1
5	A9JNR5	1356	1077	0.549	0.588	A9JNR5_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=2 SV=1
6	B3VK56	1241	1434	0.533	0.429	B3VK56_HUMAN Nitric oxide synthase OS=Homo sapiens OX=9606 GN=NOS1 PE=2 SV=1
7	F1QML0	1360	1077	0.550	0.589	F1QML0_DANRE Nitric oxide synthase OS=Danio rerio OX=7955 GN=inosb PE=3 SV=1
8	H0VEY0	726	1465	0.297	0.234	H0VEY0_CAVPO Nitric oxide synthase 1 OS=Cavia porcellus OX=10141 GN=NOS1 PE=3 SV=2
9	P29473	1144	1205	0.498	0.476	NOS3_BOVIN Nitric oxide synthase 3 OS=Bos taurus OX=9913 GN=NOS3 PE=1 SV=3
10	P29474	1155	1203	0.502	0.481	NOS3_HUMAN Nitric oxide synthase 3 OS=Homo sapiens OX=9606 GN=NOS3 PE=1 SV=4
11	P29475	1241	1434	0.533	0.429	NOS1_HUMAN Nitric oxide synthase 1 OS=Homo sapiens OX=9606 GN=NOS1 PE=1 SV=2
12	P29476	1249	1429	0.532	0.429	NOS1_RAT Nitric oxide synthase 1 OS=Rattus norvegicus OX=10116 GN=Nos1 PE=1 SV=1
13	P29477	1951	1144	0.806	0.812	NOS2_MOUSE Nitric oxide synthase, inducible OS=Mus musculus OX=10090 GN=Nos2 PE=1 SV=1
14	P35228	2415	1153	1.000	1.000	NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sapiens OX=9606 GN=NOS2 PE=1 SV=2
15	P70313	1168	1202	0.500	0.480	NOS3_MOUSE Nitric oxide synthase 3 OS=Mus musculus OX=10090 GN=Nos3 PE=1 SV=4
16	Q06518	1956	1147	0.803	0.807	NOS2_RAT Nitric oxide synthase, inducible OS=Rattus norvegicus OX=10116 GN=Nos2 PE=1 SV=2
17	Q156E2	691	761	0.288	0.436	Q156E2_ONCMY nitric-oxide synthase (NADPH) (Fragment) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
18	Q27571	943	1349	0.435	0.372	NOS_DROME Nitric oxide synthase OS=Drosophila melanogaster OX=7227 GN=Nos PE=1 SV=3
19	Q28969	1138	1205	0.496	0.475	NOS3_PIG Nitric oxide synthase 3 OS=Sus scrofa OX=9823 GN=NOS3 PE=1 SV=4
20	Q62600	1162	1202	0.499	0.478	NOS3_RAT Nitric oxide synthase 3 OS=Rattus norvegicus OX=10116 GN=Nos3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00667 FAD_binding_1	4.3e-80	280.0	FAD binding domain
2	PF00258 Flavodoxin_1	1.7e-38	143.5	Flavodoxin
3	PF00175 NAD_binding_1	3.1e-19	81.0	Oxidoreductase NAD-binding domain
4	PF08030 NAD_binding_6	4.2e+02	12.4	Ferric reductase NAD binding domain
5	PF02898 NO_synthase	1e-174	592.3	Nitric oxide synthase, oxygenase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327251

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349446	0.983	Arginase-1
2	9606.ENSP00000349467	0.981	Calmodulin-1
3	9606.ENSP00000398698	0.979	Tumor necrosis factor
4	9606.ENSP00000261783	0.972	Arginase-2, mitochondrial
5	9606.ENSP00000384273	0.968	Transcription factor p65
6	9606.ENSP00000216797	0.967	NF-kappa-B inhibitor alpha
7	9606.ENSP00000451828	0.965	RAC-alpha serine/threonine-protein kinase
8	9606.ENSP00000335153	0.963	Heat shock protein HSP 90-alpha
9	9606.ENSP00000354394	0.959	Signal transducer and activator of transcription 1-alpha/beta
10	9606.ENSP00000360266	0.956	Transcription factor AP-1
11	9606.ENSP00000241052	0.954	Catalase
12	9606.ENSP00000361471	0.954	Argininosuccinate synthase
13	9606.ENSP00000272298	0.952	Calmodulin 2 (phosphorylase kinase, delta)
14	9606.ENSP00000264657	0.949	Signal transducer and activator of transcription 3
15	9606.ENSP00000362680	0.949	Proto-oncogene tyrosine-protein kinase Src
16	9606.ENSP00000431885	0.949	Non-receptor tyrosine-protein kinase TYK2
17	9606.ENSP00000371067	0.939	Tyrosine-protein kinase JAK2
18	9606.ENSP00000330341	0.938	Suppressor of cytokine signaling 3
19	9606.ENSP00000307188	0.936	Argininosuccinate lyase
20	9606.ENSP00000385523	0.936	Peroxisome proliferator-activated receptor alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004517	1.000	nitric-oxide synthase activity
GO:0005515	0.999	protein binding
GO:1901363	0.838	heterocyclic compound binding
GO:0097159	0.837	organic cyclic compound binding
GO:0036094	0.778	small molecule binding
GO:0019899	0.731	enzyme binding
GO:0000166	0.719	nucleotide binding
GO:0042802	0.508	identical protein binding
GO:0043167	0.406	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0009987	0.992	cellular process
GO:0008152	0.991	metabolic process
GO:0044237	0.976	cellular metabolic process
GO:0065007	0.960	biological regulation
GO:0046209	0.955	nitric oxide metabolic process
GO:0006809	0.950	nitric oxide biosynthetic process
GO:0009605	0.897	response to external stimulus
GO:0009607	0.896	response to biotic stimulus
GO:0044419	0.895	biological process involved in interspecies interaction between organisms
GO:0050789	0.893	regulation of biological process
GO:0051707	0.887	response to other organism
GO:0006950	0.871	response to stress
GO:0050794	0.838	regulation of cellular process
GO:0009617	0.826	response to bacterium
GO:0071704	0.721	organic substance metabolic process
GO:0042221	0.702	response to chemical
GO:0010033	0.624	response to organic substance
GO:0006952	0.582	defense response
GO:1901700	0.532	response to oxygen-containing compound
GO:0044238	0.499	primary metabolic process
GO:1901564	0.402	organonitrogen compound metabolic process
GO:0019222	0.399	regulation of metabolic process
GO:0048518	0.379	positive regulation of biological process
GO:0048522	0.353	positive regulation of cellular process
GO:0051716	0.329	cellular response to stimulus
GO:0043436	0.303	oxoacid metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0031981	0.993	nuclear lumen
GO:0042579	0.977	microbody
GO:0005654	0.906	nucleoplasm
GO:0005777	0.825	peroxisome
GO:0016020	0.813	membrane
GO:0012505	0.567	endomembrane system
GO:0071944	0.485	cell periphery
GO:0005886	0.416	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19897	1.000	H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide
EC:1.14.13.39	1.000	nitric-oxide synthase (NADPH).

[back to server]