StarFunc result for job id P35232

User Input

>input (272 residues)
MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPW
VQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLP
SITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFT
EAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRK
LEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K401	0.731	0.731	1.327E-44	272	1.000	1.000	A8K401.pdb.gz	A8K401_HUMAN Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=2 SV=1
2	AFDB:P24156	0.937	0.924	1.705E-39	276	0.750	0.739	P24156.pdb.gz	PHB1_DROME Prohibitin 1 OS=Drosophila melanogaster OX=7227 GN=Phb1 PE=2 SV=2
3	AFDB:Q9BKU4	0.836	0.827	5.143E-35	275	0.662	0.655	Q9BKU4.pdb.gz	PHB1_CAEEL Mitochondrial prohibitin complex protein 1 OS=Caenorhabditis elegans OX=6239 GN=phb-1 PE=1 SV=1
4	AFDB:Q59SS4	0.888	0.856	3.285E-34	283	0.544	0.523	Q59SS4.pdb.gz	Q59SS4_CANAL Prohibitin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHB1 PE=3 SV=1
5	AFDB:Q9P7H3	0.883	0.853	2.223E-33	282	0.529	0.511	Q9P7H3.pdb.gz	PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phb1 PE=3 SV=1
6	AFDB:Q9LK25	0.895	0.874	7.084E-33	279	0.551	0.538	Q9LK25.pdb.gz	PHB4_ARATH Prohibitin-4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB4 PE=1 SV=1
7	AFDB:P40961	0.882	0.838	7.955E-33	287	0.526	0.498	P40961.pdb.gz	PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHB1 PE=1 SV=2
8	AFDB:O04331	0.902	0.886	2.130E-32	277	0.544	0.534	O04331.pdb.gz	PHB3_ARATH Prohibitin-3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB3 PE=1 SV=1
9	AFDB:O49460	0.860	0.815	7.740E-31	288	0.504	0.476	O49460.pdb.gz	PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB1 PE=1 SV=1
10	AFDB:P50085	0.772	0.686	8.202E-31	310	0.482	0.423	P50085.pdb.gz	PHB2_YEAST Prohibitin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHB2 PE=1 SV=2
11	PDB:7vhpG	0.582	0.533	2.729E-14	299	0.232	0.211	7vhpG.pdb.gz
12	PDB:7wi3B	0.522	0.517	1.650E-9	275	0.188	0.185	7wi3B.pdb.gz
13	PDB:4v60A	0.451	0.166	1.452E-6	812	0.118	0.039	4v60A.pdb.gz
14	PDB:7mq8NM	0.309	0.354	5.439E-3	233	0.092	0.107	7mq8NM.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:7pzyC	0.296	0.369	7.701E-3	214	0.051	0.065	7pzyC.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:4v6wAB	0.283	0.342	4.134E-2	220	0.059	0.073	4v6wAB.pdb.gz	Structures of the human and Drosophila 80S ribosome.
17	PDB:7d4iSC	0.302	0.335	4.134E-2	242	0.062	0.070	7d4iSC.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
18	PDB:4v8mA0	0.274	0.334	6.201E-2	218	0.059	0.073	4v8mA0.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:1is7A	0.184	0.243	2.965E-1	194	0.077	0.108	1is7A.pdb.gz	Crystal structure of the stimulatory complex of GTP cyclohydrolase I and its feedback regulatory protein GFRP.
20	PDB:5a3oA	0.098	0.180	3.738E-1	114	0.037	0.088	5a3oA.pdb.gz	Cinnamide Derivatives of D-Mannose as Inhibitors of the Bacterial Virulence Factor Lecb from Pseudomonas Aeruginosa

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K401	0.0	547	272	1.000	1.000	A8K401_HUMAN Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=2 SV=1
2	A8W340	0.0	547	272	1.000	1.000	A8W340_CANLF Prohibitin OS=Canis lupus familiaris OX=9615 GN=PHB1 PE=2 SV=1
3	P35232	0.0	547	272	1.000	1.000	PHB1_HUMAN Prohibitin 1 OS=Homo sapiens OX=9606 GN=PHB1 PE=1 SV=1
4	P67778	0.0	546	272	0.996	0.996	PHB1_MOUSE Prohibitin 1 OS=Mus musculus OX=10090 GN=Phb1 PE=1 SV=1
5	P67779	0.0	546	272	0.996	0.996	PHB1_RAT Prohibitin 1 OS=Rattus norvegicus OX=10116 GN=Phb1 PE=1 SV=1
6	P84173	0.0	535	272	0.963	0.963	PHB1_CHICK Prohibitin 1 OS=Gallus gallus OX=9031 GN=PHB1 PE=1 SV=1
7	C9JW96	6.61e-179	494	246	0.904	1.000	C9JW96_HUMAN Prohibitin (Fragment) OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=2
8	E9PCW0	6.57e-157	437	216	0.794	1.000	E9PCW0_HUMAN Prohibitin (Fragment) OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=2
9	P24156	1.28e-152	428	276	0.750	0.739	PHB1_DROME Prohibitin 1 OS=Drosophila melanogaster OX=7227 GN=Phb1 PE=2 SV=2
10	C9JZ20	1.63e-131	373	218	0.695	0.867	C9JZ20_HUMAN Prohibitin OS=Homo sapiens OX=9606 GN=PHB1 PE=1 SV=2
11	Q9BKU4	4.08e-126	361	275	0.654	0.647	PHB1_CAEEL Mitochondrial prohibitin complex protein 1 OS=Caenorhabditis elegans OX=6239 GN=phb-1 PE=1 SV=1
12	Q59SS4	3.61e-108	316	283	0.540	0.519	Q59SS4_CANAL Prohibitin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PHB1 PE=3 SV=1
13	Q9LK25	6.16e-107	313	279	0.551	0.538	PHB4_ARATH Prohibitin-4, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB4 PE=1 SV=1
14	P40961	1.38e-106	312	287	0.522	0.495	PHB1_YEAST Prohibitin-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHB1 PE=1 SV=2
15	O04331	2.21e-106	311	277	0.551	0.542	PHB3_ARATH Prohibitin-3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB3 PE=1 SV=1
16	Q9P7H3	7.64e-105	308	282	0.526	0.507	PHB1_SCHPO Prohibitin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=phb1 PE=3 SV=1
17	O49460	2.10e-95	284	288	0.493	0.465	PHB1_ARATH Prohibitin-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB1 PE=1 SV=1
18	Q9ZNT7	1.18e-94	282	286	0.500	0.476	PHB2_ARATH Prohibitin-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB2 PE=1 SV=1
19	Q9SIL6	5.78e-94	280	286	0.518	0.493	PHB6_ARATH Prohibitin-6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB6 PE=1 SV=1
20	Q9FFH5	6.51e-94	280	278	0.511	0.500	PHB7_ARATH Prohibitin-7, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=PHB7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01145 Band_7	3.9e-24	97.1	SPFH domain / Band 7 family
2	PF11214 Med2	31	16.2	Mediator complex subunit 2

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 225400.XP_006774305.1

Rank	PPI partner	STRING score	Description
1	225400.XP_006757612.1	0.999	Prohibitin-2
2	225400.XP_006758353.1	0.970	RAF proto-oncogene serine/threonine-protein kinase
3	225400.XP_006763324.1	0.945	AFG3-like protein 2
4	225400.XP_006762241.1	0.924	SPG7, paraplegin matrix AAA peptidase subunit
5	225400.XP_006771972.1	0.892	Complement component 1 Q subcomponent-binding protein, mitochondrial
6	225400.XP_006765904.1	0.866	Voltage-dependent anion-selective channel protein 2
7	225400.XP_006772593.1	0.863	ATPase family AAA domain-containing protein 3-like
8	225400.XP_006759621.1	0.852	Mitochondrial import receptor subunit TOM40 homolog
9	225400.XP_006764801.1	0.850	Mitochondrial import receptor subunit TOM40B
10	225400.XP_006777194.1	0.848	Serine/threonine-protein kinase B-raf
11	225400.XP_006772195.1	0.847	Serine/threonine-protein kinase A-Raf isoform X1
12	225400.XP_006765587.1	0.833	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
13	225400.XP_006772546.1	0.829	Stress-70 protein, mitochondrial
14	225400.XP_006767861.1	0.827	ATP-dependent zinc metalloprotease YME1L1
15	225400.XP_006761715.1	0.823	Acts as a tumor suppressor in many tumor types
16	225400.XP_006777443.1	0.821	Histone deacetylase 1
17	225400.XP_006779724.1	0.821	ATP synthase subunit beta, mitochondrial
18	225400.XP_006759478.1	0.820	NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial isoform X1
19	225400.XP_006763104.1	0.817	GTPase NRas
20	225400.XP_006753624.1	0.789	Voltage-dependent anion-selective channel protein 1 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.481	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.992	regulation of biological process
GO:0009987	0.973	cellular process
GO:0050794	0.971	regulation of cellular process
GO:0050896	0.920	response to stimulus
GO:0019222	0.859	regulation of metabolic process
GO:0048519	0.759	negative regulation of biological process
GO:0048522	0.717	positive regulation of cellular process
GO:0048583	0.708	regulation of response to stimulus
GO:0060255	0.678	regulation of macromolecule metabolic process
GO:0071704	0.631	organic substance metabolic process
GO:0031323	0.597	regulation of cellular metabolic process
GO:0048523	0.590	negative regulation of cellular process
GO:0080090	0.585	regulation of primary metabolic process
GO:0051171	0.585	regulation of nitrogen compound metabolic process
GO:0044238	0.580	primary metabolic process
GO:0044237	0.555	cellular metabolic process
GO:0006807	0.546	nitrogen compound metabolic process
GO:0010468	0.461	regulation of gene expression
GO:0023051	0.460	regulation of signaling
GO:0016043	0.425	cellular component organization
GO:0009892	0.415	negative regulation of metabolic process
GO:0051716	0.412	cellular response to stimulus
GO:0010646	0.409	regulation of cell communication
GO:0010605	0.384	negative regulation of macromolecule metabolic process
GO:0043170	0.374	macromolecule metabolic process
GO:0006950	0.362	response to stress
GO:0031326	0.356	regulation of cellular biosynthetic process
GO:0010556	0.341	regulation of macromolecule biosynthetic process
GO:0009966	0.341	regulation of signal transduction
GO:0010647	0.326	positive regulation of cell communication
GO:1901564	0.321	organonitrogen compound metabolic process
GO:0023056	0.319	positive regulation of signaling
GO:0009967	0.314	positive regulation of signal transduction
GO:1902531	0.311	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.998	mitochondrion
GO:0032991	0.955	protein-containing complex
GO:0016020	0.953	membrane
GO:0070013	0.867	intracellular organelle lumen
GO:0005634	0.836	nucleus
GO:0031982	0.521	vesicle
GO:0012505	0.432	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]