StarFunc result for job id P35237

User Input

>input (376 residues)
MDVLAEANGTFALNLLKTLGKDNSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFN
KSGGGGDIHQGFQSLLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEE
LDFISAVEKSRKHINTWVAEKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKE
NTEERLFKVSKNEEKPVQMMFKQSTFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTD
LRTVEKELTYEKFVEWTRLDMMDEEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKA
DFSGMSQTDLSLSKVVHKSFVEVNEEGTEAAAATAAIMMMRCARFVPRFCADHPFLFFIQ
HSKTNGILFCGRFSSP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35237	1.000	1.000	2.124E-83	376	1.000	1.000	P35237.pdb.gz	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
2	AFDB:Q60854	0.971	0.966	1.278E-69	378	0.766	0.762	Q60854.pdb.gz	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
3	AFDB:O08804	0.968	0.965	2.359E-66	377	0.721	0.719	O08804.pdb.gz	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2
4	AFDB:P50452	0.969	0.974	4.899E-63	374	0.670	0.674	P50452.pdb.gz	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
5	AFDB:A0A024QZT4	0.956	0.956	4.017E-61	376	0.630	0.630	A0A024QZT4.pdb.gz	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
6	AFDB:O08797	0.961	0.966	1.258E-57	374	0.564	0.567	O08797.pdb.gz	O08797_MOUSE SPI6 OS=Mus musculus OX=10090 GN=Serpinb9 PE=1 SV=1
7	AFDB:Q3TJ69	0.949	0.946	1.898E-57	377	0.537	0.536	Q3TJ69.pdb.gz	Q3TJ69_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
8	AFDB:P30740	0.970	0.963	1.320E-56	379	0.513	0.509	P30740.pdb.gz	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
9	AFDB:Q80UK5	0.951	0.948	1.484E-56	377	0.551	0.549	Q80UK5.pdb.gz	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
10	AFDB:Q9D154	0.962	0.955	8.156E-56	379	0.500	0.496	Q9D154.pdb.gz	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
11	PDB:4ga7A	0.929	0.947	3.787E-52	369	0.492	0.501	4ga7A.pdb.gz
12	PDB:2zv6B	0.932	0.945	1.669E-47	371	0.471	0.477	2zv6B.pdb.gz
13	PDB:2h4rA	0.927	0.939	8.155E-47	371	0.452	0.458	2h4rA.pdb.gz
14	PDB:2arqA	0.892	0.930	6.761E-46	360	0.476	0.497	2arqA.pdb.gz	Plasminogen activator inhibitor-2 is highly tolerant to P8 residue substitution--implications for serpin mechanistic model and prediction of nsSNP activities
15	PDB:1xqgA	0.915	0.911	5.483E-43	378	0.375	0.373	1xqgA.pdb.gz
16	PDB:2ol2A	0.872	0.909	5.363E-41	360	0.324	0.339	2ol2A.pdb.gz
17	PDB:1hp7A	0.921	0.921	1.440E-39	376	0.322	0.322	1hp7A.pdb.gz	A 2.1 A resolution structure of an uncleaved alpha(1)-antitrypsin shows variability of the reactive center and other loops.
18	PDB:1yxaA	0.891	0.900	1.527E-39	372	0.343	0.347	1yxaA.pdb.gz
19	PDB:1jmoA	0.890	0.788	3.091E-39	427	0.309	0.272	1jmoA.pdb.gz
20	PDB:4dteA	0.882	0.887	1.699E-38	374	0.298	0.299	4dteA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O08804	0.0	527	377	0.729	0.727	O08804_MOUSE NK13 OS=Mus musculus OX=10090 GN=Serpinb6b PE=1 SV=2
2	P35237	0.0	781	376	1.000	1.000	SPB6_HUMAN Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3
3	Q60854	0.0	567	378	0.766	0.762	SPB6_MOUSE Serpin B6 OS=Mus musculus OX=10090 GN=Serpinb6 PE=1 SV=1
4	P50452	3.11e-175	494	374	0.673	0.676	SPB8_HUMAN Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8 PE=1 SV=2
5	A0A024QZT4	5.58e-175	493	376	0.633	0.633	A0A024QZT4_HUMAN Testicular tissue protein Li 180 OS=Homo sapiens OX=9606 PE=2 SV=1
6	P50453	5.58e-175	493	376	0.633	0.633	SPB9_HUMAN Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1
7	O08797	3.19e-148	426	374	0.564	0.567	O08797_MOUSE SPI6 OS=Mus musculus OX=10090 GN=Serpinb9 PE=1 SV=1
8	Q80UK5	4.91e-147	422	377	0.553	0.552	Q80UK5_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9f OS=Mus musculus OX=10090 GN=Serpinb9f PE=2 SV=1
9	Q6P217	1.60e-134	391	377	0.548	0.546	Q6P217_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 9b OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
10	Q9DAV6	3.54e-134	390	377	0.545	0.544	Q9DAV6_MOUSE R86 OS=Mus musculus OX=10090 GN=Serpinb9b PE=1 SV=1
11	Q3TJ69	8.09e-133	386	377	0.543	0.541	Q3TJ69_MOUSE Serpin domain-containing protein OS=Mus musculus OX=10090 GN=Serpinb9b PE=2 SV=1
12	Q8BHL1	1.39e-122	361	387	0.479	0.465	Q8BHL1_MOUSE Squamous cell carcinoma antigen 2 related protein 1 OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
13	Q6UKZ2	1.13e-121	358	387	0.476	0.463	Q6UKZ2_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B (Ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=2 SV=1
14	Q9D1Q5	1.24e-120	356	387	0.479	0.465	Q9D1Q5_MOUSE Serine (or cysteine) peptidase inhibitor, clade B (ovalbumin), member 3B OS=Mus musculus OX=10090 GN=Serpinb3b PE=1 SV=1
15	Q9D154	2.28e-120	355	379	0.505	0.501	ILEUA_MOUSE Leukocyte elastase inhibitor A OS=Mus musculus OX=10090 GN=Serpinb1a PE=1 SV=1
16	P05120	3.54e-120	355	415	0.503	0.455	PAI2_HUMAN Plasminogen activator inhibitor 2 OS=Homo sapiens OX=9606 GN=SERPINB2 PE=1 SV=2
17	P30740	4.81e-119	351	379	0.519	0.515	ILEU_HUMAN Leukocyte elastase inhibitor OS=Homo sapiens OX=9606 GN=SERPINB1 PE=1 SV=1
18	V9HWH1	4.81e-119	351	379	0.519	0.515	V9HWH1_HUMAN Epididymis luminal protein 57 OS=Homo sapiens OX=9606 GN=HEL57 PE=2 SV=1
19	P48595	1.81e-116	345	397	0.476	0.451	SPB10_HUMAN Serpin B10 OS=Homo sapiens OX=9606 GN=SERPINB10 PE=1 SV=1
20	A2RSF9	3.94e-115	342	386	0.479	0.466	A2RSF9_MOUSE Serine (Or cysteine) peptidase inhibitor, clade B, member 3C OS=Mus musculus OX=10090 GN=Serpinb3c PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16389 DUF4998	80	14.2	Domain of unknown function
2	PF00079 Serpin	1e-126	434.8	Serpin (serine protease inhibitor)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484343

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361850	0.937	Urokinase-type plasminogen activator
2	9606.ENSP00000216336	0.911	Cathepsin G
3	9606.ENSP00000401645	0.909	Plasminogen activator inhibitor 2
4	9606.ENSP00000339328	0.902	Urokinase plasminogen activator surface receptor
5	9606.ENSP00000313581	0.844	Kallikrein-2
6	9606.ENSP00000264596	0.757	Endonuclease 8-like 3
7	9606.ENSP00000375682	0.757	Kallikrein-8
8	9606.ENSP00000333203	0.756	Plasma serine protease inhibitor
9	9606.ENSP00000433138	0.748	Caspase-1
10	9606.ENSP00000364858	0.739	Caspase recruitment domain-containing protein 16
11	9606.ENSP00000227163	0.662	Transcription factor PU.1
12	9606.ENSP00000325548	0.662	Cytosolic non-specific dipeptidase
13	9606.ENSP00000334836	0.645	BMP-2-inducible protein kinase
14	9606.ENSP00000325146	0.640	Collagen alpha-1(XII) chain
15	9606.ENSP00000373472	0.640	A disintegrin and metalloproteinase with thrombospondin motifs 7
16	9606.ENSP00000300527	0.579	Collagen alpha-2(VI) chain
17	9606.ENSP00000246186	0.573	Matrix metalloproteinase-24
18	9606.ENSP00000284984	0.564	A disintegrin and metalloproteinase with thrombospondin motifs 1
19	9606.ENSP00000430128	0.558	RNA-binding Raly-like protein
20	9606.ENSP00000308541	0.556	Prothrombin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004867	1.000	serine-type endopeptidase inhibitor activity
GO:0019899	0.884	enzyme binding
GO:0002020	0.784	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0010951	0.985	negative regulation of endopeptidase activity
GO:0050896	0.982	response to stimulus
GO:0009987	0.973	cellular process
GO:0032501	0.852	multicellular organismal process
GO:0051716	0.831	cellular response to stimulus
GO:0050794	0.815	regulation of cellular process
GO:0006950	0.764	response to stress
GO:0104004	0.677	cellular response to environmental stimulus
GO:0009628	0.669	response to abiotic stimulus
GO:0042221	0.479	response to chemical
GO:0050877	0.425	nervous system process
GO:0007600	0.420	sensory perception
GO:0070887	0.409	cellular response to chemical stimulus
GO:0006970	0.408	response to osmotic stress
GO:0048523	0.343	negative regulation of cellular process
GO:0048518	0.329	positive regulation of biological process
GO:0048583	0.325	regulation of response to stimulus
GO:0050954	0.324	sensory perception of mechanical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005737	0.998	cytoplasm
GO:0043227	0.996	membrane-bounded organelle
GO:0012505	0.994	endomembrane system
GO:0043231	0.992	intracellular membrane-bounded organelle
GO:0032991	0.987	protein-containing complex
GO:0016020	0.986	membrane
GO:0071944	0.978	cell periphery
GO:0005634	0.959	nucleus
GO:0005829	0.922	cytosol
GO:0031982	0.891	vesicle
GO:0097708	0.827	intracellular vesicle
GO:0031410	0.806	cytoplasmic vesicle
GO:0070062	0.804	extracellular exosome
GO:0031090	0.802	organelle membrane
GO:0031012	0.777	extracellular matrix
GO:0005886	0.691	plasma membrane
GO:0030141	0.681	secretory granule
GO:0062023	0.604	collagen-containing extracellular matrix
GO:0070013	0.437	intracellular organelle lumen
GO:0030667	0.336	secretory granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]