StarFunc result for job id P35240

User Input

>input (595 residues)
MAGAIASRMSFSSLKRKQPKTFTVRIVTMDAEMEFNCEMKWKGKDLFDLVCRTLGLRETW
FFGLQYTIKDTVAWLKMDKKVLDHDVSKEEPVTFHFLAKFYPENAEEELVQEITQHLFFL
QVKKQILDEKIYCPPEASVLLASYAVQAKYGDYDPSVHKRGFLAQEELLPKRVINLYQMT
PEMWEERITAWYAEHRGRARDEAEMEYLKIAQDLEMYGVNYFAIRNKKGTELLLGVDALG
LHIYDPENRLTPKISFPWNEIRNISYSDKEFTIKPLDKKIDVFKFNSSKLRVNKLILQLC
IGNHDLFMRRRKADSLEVQQMKAQAREEKARKQMERQRLAREKQMREEAERTRDELERRL
LQMKEEATMANEALMRSEETADLLAEKAQITEEEAKLLAQKAAEAEQEMQRIKATAIRTE
EEKRLMEQKVLEAEVLALKMAEESERRAKEADQLKQDLQEAREAERRAKQKLLEIATKPT
YPPMNPIPAPLPPDIPSFNLIGDSLSFDFKDTDMKRLSMEIEKEKVEYMEKSKHLQEQLN
ELKTEIEALKLKERETALDILHNENSDRGGSSKHNTIKKLTLQSAKSRVAFFEEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P46662	0.959	0.958	2.741E-90	596	0.985	0.983	P46662.pdb.gz	MERL_MOUSE Merlin OS=Mus musculus OX=10090 GN=Nf2 PE=1 SV=2
2	AFDB:A0A024R1F6	0.845	0.912	1.069E-71	549	0.897	0.973	A0A024R1F6.pdb.gz
3	AFDB:Q24564	0.760	0.714	8.790E-51	635	0.487	0.457	Q24564.pdb.gz	MERH_DROME Moesin/ezrin/radixin homolog 2 OS=Drosophila melanogaster OX=7227 GN=Mer PE=1 SV=1
4	AFDB:P46150	0.869	0.894	1.030E-50	578	0.424	0.436	P46150.pdb.gz	MOEH_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Moe PE=1 SV=2
5	AFDB:P15311	0.717	0.726	1.006E-49	586	0.450	0.457	P15311.pdb.gz	EZRI_HUMAN Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4
6	AFDB:Q5TZG5	0.710	0.724	1.620E-49	583	0.449	0.458	Q5TZG5.pdb.gz	Q5TZG5_DANRE Ezrin OS=Danio rerio OX=7955 GN=ezr PE=1 SV=1
7	AFDB:O35763	0.714	0.736	8.371E-49	577	0.439	0.452	O35763.pdb.gz	MOES_RAT Moesin OS=Rattus norvegicus OX=10116 GN=Msn PE=1 SV=3
8	AFDB:G5EBK3	0.733	0.769	1.581E-48	564	0.408	0.431	G5EBK3.pdb.gz	G5EBK3_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=erm-1 PE=1 SV=1
9	AFDB:Q66I42	0.700	0.718	5.071E-48	579	0.427	0.439	Q66I42.pdb.gz	Q66I42_DANRE Moesin OS=Danio rerio OX=7955 GN=rdx PE=1 SV=1
10	AFDB:E9PT65	0.713	0.728	5.133E-42	583	0.422	0.431	E9PT65.pdb.gz	E9PT65_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=3
11	PDB:4rm8A	0.489	0.786	5.273E-38	368	0.308	0.497	4rm8A.pdb.gz
12	PDB:6r9tA	0.230	0.074	4.282E-10	2185	0.108	0.029	6r9tA.pdb.gz
13	PDB:7c3mA	0.400	0.412	2.343E-7	577	0.084	0.087	7c3mA.pdb.gz
14	PDB:5yqrA	0.143	0.272	3.078E-3	268	0.067	0.149	5yqrA.pdb.gz
15	PDB:4iapA	0.114	0.253	6.130E-3	256	0.067	0.156	4iapA.pdb.gz
16	PDB:6mdhA	0.115	0.433	7.989E-3	149	0.015	0.060	6mdhA.pdb.gz
17	PDB:3pvuA	0.138	0.135	1.431E-2	609	0.035	0.034	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
18	PDB:4mt6A	0.163	0.236	1.431E-2	389	0.050	0.077	4mt6A.pdb.gz
19	PDB:3dbhI	0.120	0.722	1.966E-2	86	0.022	0.151	3dbhI.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
20	PDB:7r03B	0.115	0.032	2.305E-2	2246	0.022	0.006	7r03B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW66	0.0	781	401	0.674	1.000	A0A5K1VW66_HUMAN NF2, moesin-ezrin-radixin like (MERLIN) tumor suppressor (Fragment) OS=Homo sapiens OX=9606 GN=NF2 PE=1 SV=1
2	A0A8C0RSL8	0.0	1181	597	0.978	0.975	A0A8C0RSL8_CANLF Neurofibromin 2 OS=Canis lupus familiaris OX=9615 GN=NF2 PE=1 SV=1
3	P35240	0.0	1216	595	1.000	1.000	MERL_HUMAN Merlin OS=Homo sapiens OX=9606 GN=NF2 PE=1 SV=1
4	P46662	0.0	1197	596	0.985	0.983	MERL_MOUSE Merlin OS=Mus musculus OX=10090 GN=Nf2 PE=1 SV=2
5	Q24564	0.0	557	635	0.494	0.463	MERH_DROME Moesin/ezrin/radixin homolog 2 OS=Drosophila melanogaster OX=7227 GN=Mer PE=1 SV=1
6	Q63648	0.0	1154	586	0.948	0.962	MERL_RAT Merlin (Fragment) OS=Rattus norvegicus OX=10116 GN=Nf2 PE=1 SV=1
7	P15311	1.54e-161	476	586	0.454	0.461	EZRI_HUMAN Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4
8	P46150	2.40e-161	475	578	0.454	0.467	MOEH_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Moe PE=1 SV=2
9	P26038	1.29e-160	473	577	0.466	0.480	MOES_HUMAN Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3
10	V9HWC0	1.29e-160	473	577	0.466	0.480	V9HWC0_HUMAN Epididymis luminal protein 70 OS=Homo sapiens OX=9606 GN=HEL70 PE=2 SV=1
11	Q5TZG5	2.00e-159	470	583	0.445	0.455	Q5TZG5_DANRE Ezrin OS=Danio rerio OX=7955 GN=ezr PE=1 SV=1
12	O35763	6.18e-159	469	577	0.461	0.475	MOES_RAT Moesin OS=Rattus norvegicus OX=10116 GN=Msn PE=1 SV=3
13	P26041	1.13e-158	468	577	0.461	0.475	MOES_MOUSE Moesin OS=Mus musculus OX=10090 GN=Msn PE=1 SV=3
14	P26040	1.57e-158	468	586	0.452	0.459	EZRI_MOUSE Ezrin OS=Mus musculus OX=10090 GN=Ezr PE=1 SV=3
15	P31977	2.31e-158	468	586	0.450	0.457	EZRI_RAT Ezrin OS=Rattus norvegicus OX=10116 GN=Ezr PE=1 SV=3
16	P26043	4.48e-156	462	583	0.398	0.407	RADI_MOUSE Radixin OS=Mus musculus OX=10090 GN=Rdx PE=1 SV=3
17	G5EES2	8.01e-156	460	563	0.413	0.437	G5EES2_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=erm-1 PE=1 SV=1
18	Q5PQK5	9.77e-156	461	583	0.397	0.405	Q5PQK5_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=4 SV=1
19	Q5WQV5	2.79e-155	459	583	0.395	0.403	Q5WQV5_RAT Radixin OS=Rattus norvegicus OX=10116 PE=1 SV=1
20	B0YJ88	3.32e-155	459	583	0.397	0.405	B0YJ88_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00769 ERM_C	2.9e-21	87.0	Ezrin/radixin/moesin family C terminal
2	PF20492 ERM_helical	4.3e-17	73.7	Ezrin/radixin/moesin, alpha-helical domain
3	PF09380 FERM_C	3.7e-21	86.6	FERM C-terminal PH-like domain
4	PF00373 FERM_M	2.3e-19	81.3	FERM central domain
5	PF09379 FERM_N	3.4e-10	51.0	FERM N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010357711.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010351591.1	0.990	Angiomotin isoform X1
2	61622.XP_010356496.1	0.984	WW and C2 domain containing 1
3	61622.XP_010359560.1	0.971	Large tumor suppressor kinase 2
4	61622.XP_010358872.1	0.968	Angiomotin-like protein 1 isoform X1
5	61622.XP_010375069.1	0.959	FERM domain-containing protein 6 isoform X1
6	61622.XP_010379898.1	0.953	DDB1 and CUL4 associated factor 1
7	61622.XP_010385956.1	0.950	Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression
8	61622.XP_010363152.1	0.943	Angiomotin like 2
9	61622.XP_010379341.1	0.943	Large tumor suppressor kinase 1
10	61622.XP_010352597.1	0.941	Hepatocyte growth factor-regulated tyrosine kinase substrate isoform X1
11	61622.XP_010356677.1	0.936	CD44 molecule (Indian blood group)
12	61622.XP_010386157.1	0.922	SLC9A3 regulator 2
13	61622.XP_010382124.1	0.908	FERM domain-containing protein 1 isoform X1
14	61622.XP_010380008.1	0.895	Mediator of RNA polymerase II transcription subunit 28 isoform X1
15	61622.XP_010377199.1	0.887	Spectrin beta chain, non-erythrocytic 1 isoform X1
16	61622.XP_010376210.1	0.872	Protein WWC2 isoform X1
17	61622.XP_010366586.1	0.858	Paxillin
18	61622.XP_010351166.1	0.845	Protein WWC3
19	61622.XP_010368974.1	0.825	PATJ, crumbs cell polarity complex component
20	61622.XP_010362652.1	0.803	Cell division cycle 42

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008092	0.303	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0048523	0.991	negative regulation of cellular process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0051174	0.982	regulation of phosphorus metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0080090	0.973	regulation of primary metabolic process
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0048518	0.972	positive regulation of biological process
GO:0051128	0.969	regulation of cellular component organization
GO:0032502	0.941	developmental process
GO:0042325	0.935	regulation of phosphorylation
GO:0001932	0.931	regulation of protein phosphorylation
GO:0048856	0.930	anatomical structure development
GO:0048522	0.930	positive regulation of cellular process
GO:0023051	0.923	regulation of signaling
GO:0032501	0.918	multicellular organismal process
GO:0010646	0.914	regulation of cell communication
GO:0048583	0.909	regulation of response to stimulus
GO:0071840	0.907	cellular component organization or biogenesis
GO:0007275	0.902	multicellular organism development
GO:0050896	0.897	response to stimulus
GO:0016043	0.896	cellular component organization
GO:0048869	0.865	cellular developmental process
GO:0042127	0.851	regulation of cell population proliferation
GO:0010605	0.848	negative regulation of macromolecule metabolic process
GO:0030155	0.844	regulation of cell adhesion
GO:0051172	0.843	negative regulation of nitrogen compound metabolic process
GO:0031324	0.842	negative regulation of cellular metabolic process
GO:0030154	0.831	cell differentiation
GO:0051248	0.811	negative regulation of protein metabolic process
GO:0048731	0.803	system development
GO:0008285	0.803	negative regulation of cell population proliferation
GO:0045859	0.761	regulation of protein kinase activity
GO:0009966	0.760	regulation of signal transduction
GO:0014009	0.750	glial cell proliferation
GO:0051716	0.732	cellular response to stimulus
GO:1902531	0.725	regulation of intracellular signal transduction
GO:0009968	0.711	negative regulation of signal transduction
GO:0040012	0.698	regulation of locomotion
GO:0051239	0.685	regulation of multicellular organismal process
GO:0031400	0.670	negative regulation of protein modification process
GO:0050793	0.668	regulation of developmental process
GO:0042326	0.647	negative regulation of phosphorylation
GO:0001933	0.600	negative regulation of protein phosphorylation
GO:0007154	0.597	cell communication
GO:0023052	0.581	signaling
GO:0009888	0.573	tissue development
GO:0009893	0.572	positive regulation of metabolic process
GO:0048468	0.568	cell development
GO:0007165	0.567	signal transduction
GO:0045595	0.546	regulation of cell differentiation
GO:0048513	0.510	animal organ development
GO:0032956	0.497	regulation of actin cytoskeleton organization
GO:2000026	0.492	regulation of multicellular organismal development
GO:0051241	0.465	negative regulation of multicellular organismal process
GO:0010604	0.449	positive regulation of macromolecule metabolic process
GO:0044087	0.435	regulation of cellular component biogenesis
GO:0051173	0.430	positive regulation of nitrogen compound metabolic process
GO:0031325	0.426	positive regulation of cellular metabolic process
GO:0010468	0.412	regulation of gene expression
GO:0051093	0.405	negative regulation of developmental process
GO:1902903	0.401	regulation of supramolecular fiber organization
GO:0045596	0.393	negative regulation of cell differentiation
GO:0110053	0.390	regulation of actin filament organization
GO:0009653	0.360	anatomical structure morphogenesis
GO:0035556	0.352	intracellular signal transduction
GO:2000145	0.343	regulation of cell motility
GO:0019219	0.342	regulation of nucleobase-containing compound metabolic process
GO:0008152	0.339	metabolic process
GO:0009889	0.317	regulation of biosynthetic process
GO:0031326	0.314	regulation of cellular biosynthetic process
GO:0010556	0.312	regulation of macromolecule biosynthetic process
GO:0051252	0.307	regulation of RNA metabolic process
GO:0051179	0.304	localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005829	0.979	cytosol
GO:0043226	0.839	organelle
GO:0043229	0.831	intracellular organelle
GO:0043227	0.815	membrane-bounded organelle
GO:0043231	0.810	intracellular membrane-bounded organelle
GO:0005634	0.781	nucleus
GO:0031974	0.344	membrane-enclosed lumen
GO:0070013	0.302	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]