StarFunc result for job id P35241

User Input

>input (583 residues)
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PT65	0.872	0.872	1.062E-80	583	0.907	0.907	E9PT65.pdb.gz	E9PT65_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=3
2	AFDB:O35763	0.852	0.861	1.169E-76	577	0.791	0.799	O35763.pdb.gz	MOES_RAT Moesin OS=Rattus norvegicus OX=10116 GN=Msn PE=1 SV=3
3	AFDB:Q66I42	0.803	0.809	1.116E-75	579	0.777	0.782	Q66I42.pdb.gz	Q66I42_DANRE Moesin OS=Danio rerio OX=7955 GN=rdx PE=1 SV=1
4	AFDB:P15311	0.808	0.804	2.346E-74	586	0.741	0.737	P15311.pdb.gz	EZRI_HUMAN Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4
5	AFDB:Q5TZG5	0.812	0.812	1.274E-73	583	0.760	0.760	Q5TZG5.pdb.gz	Q5TZG5_DANRE Ezrin OS=Danio rerio OX=7955 GN=ezr PE=1 SV=1
6	AFDB:P46150	0.753	0.759	1.667E-63	578	0.599	0.604	P46150.pdb.gz	MOEH_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Moe PE=1 SV=2
7	AFDB:G5EBK3	0.732	0.755	4.435E-61	564	0.552	0.571	G5EBK3.pdb.gz	G5EBK3_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=erm-1 PE=1 SV=1
8	PDB:4rm8A	0.622	0.980	9.546E-53	368	0.528	0.837	4rm8A.pdb.gz
9	AFDB:Q24564	0.731	0.672	3.457E-52	635	0.439	0.403	Q24564.pdb.gz	MERH_DROME Moesin/ezrin/radixin homolog 2 OS=Drosophila melanogaster OX=7227 GN=Mer PE=1 SV=1
10	AFDB:P46662	0.698	0.683	3.213E-48	596	0.463	0.453	P46662.pdb.gz	MERL_MOUSE Merlin OS=Mus musculus OX=10090 GN=Nf2 PE=1 SV=2
11	AFDB:H2KYX3	0.751	0.624	1.595E-39	709	0.341	0.281	H2KYX3.pdb.gz	H2KYX3_CAEEL FERM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=nfm-1 PE=1 SV=1
12	PDB:6r9tA	0.232	0.074	5.354E-9	2185	0.074	0.020	6r9tA.pdb.gz
13	PDB:7c3mA	0.373	0.377	1.492E-7	577	0.089	0.090	7c3mA.pdb.gz
14	PDB:5itdA	0.132	0.079	4.750E-4	995	0.051	0.030	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
15	PDB:5swpA	0.130	0.073	5.953E-4	1060	0.036	0.020	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
16	PDB:6mdhA	0.121	0.452	1.468E-3	149	0.021	0.081	6mdhA.pdb.gz
17	PDB:5dxhD	0.133	0.081	2.059E-3	981	0.043	0.025	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
18	PDB:3tixA	0.155	0.508	2.305E-3	153	0.045	0.170	3tixA.pdb.gz
19	PDB:3pgeA	0.123	0.387	2.438E-3	172	0.022	0.076	3pgeA.pdb.gz
20	PDB:6pyuA	0.127	0.081	2.438E-3	930	0.029	0.018	6pyuA.pdb.gz	Design of selective PI3K delta inhibitors using an iterative scaffold-hopping workflow.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K095	1144	580	0.962	0.967	A0A0G2K095_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=2
2	A0A8I5ZR70	1145	582	0.962	0.964	A0A8I5ZR70_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=1
3	A0A8I6AIS5	945	538	0.894	0.968	A0A8I6AIS5_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=1
4	B0YJ88	1186	583	1.000	1.000	B0YJ88_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=2 SV=1
5	E9PT65	1162	604	0.976	0.942	E9PT65_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=1 SV=3
6	G5EBK3	622	564	0.564	0.583	G5EBK3_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=erm-1 PE=1 SV=1
7	G5EES2	624	563	0.566	0.586	G5EES2_CAEEL Moesin/ezrin/radixin homolog 1 OS=Caenorhabditis elegans OX=6239 GN=erm-1 PE=1 SV=1
8	O35763	921	577	0.806	0.815	MOES_RAT Moesin OS=Rattus norvegicus OX=10116 GN=Msn PE=1 SV=3
9	P15311	912	586	0.767	0.763	EZRI_HUMAN Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4
10	P26038	929	577	0.810	0.818	MOES_HUMAN Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3
11	P26040	885	586	0.762	0.758	EZRI_MOUSE Ezrin OS=Mus musculus OX=10090 GN=Ezr PE=1 SV=3
12	P26041	929	577	0.811	0.820	MOES_MOUSE Moesin OS=Mus musculus OX=10090 GN=Msn PE=1 SV=3
13	P26043	1173	583	0.985	0.985	RADI_MOUSE Radixin OS=Mus musculus OX=10090 GN=Rdx PE=1 SV=3
14	P31977	886	586	0.762	0.758	EZRI_RAT Ezrin OS=Rattus norvegicus OX=10116 GN=Ezr PE=1 SV=3
15	P35241	1186	583	1.000	1.000	RADI_HUMAN Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1
16	P46150	679	578	0.605	0.611	MOEH_DROME Moesin/ezrin/radixin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Moe PE=1 SV=2
17	Q5PQK5	1163	583	0.976	0.976	Q5PQK5_RAT Radixin OS=Rattus norvegicus OX=10116 GN=Rdx PE=4 SV=1
18	Q5TZG5	913	583	0.780	0.780	Q5TZG5_DANRE Ezrin OS=Danio rerio OX=7955 GN=ezr PE=1 SV=1
19	Q5WQV5	1162	583	0.974	0.974	Q5WQV5_RAT Radixin OS=Rattus norvegicus OX=10116 PE=1 SV=1
20	Q66I42	893	579	0.815	0.820	Q66I42_DANRE Moesin OS=Danio rerio OX=7955 GN=rdx PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00769 ERM_C	1.3e-30	116.9	Ezrin/radixin/moesin family C terminal
2	PF20492 ERM_helical	2.6e-27	106.7	Ezrin/radixin/moesin, alpha-helical domain
3	PF09380 FERM_C	3e-24	96.6	FERM C-terminal PH-like domain
4	PF00373 FERM_M	2e-22	91.2	FERM central domain
5	PF09379 FERM_N	6.9e-16	69.2	FERM N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010359620.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010385956.1	0.993	Scaffold protein that connects plasma membrane proteins with members of the ezrin/moesin/radixin family and thereby helps to link them to the actin cytoskeleton and to regulate their surface expression
2	61622.XP_010379833.1	0.974	Ezrin
3	61622.XP_010378321.1	0.956	Intercellular adhesion molecule 2
4	61622.XP_010386157.1	0.954	SLC9A3 regulator 2
5	61622.XP_010377679.1	0.917	Moesin
6	61622.XP_010352583.1	0.902	Actin gamma 1
7	61622.XP_010365296.1	0.902	Actin, cytoplasmic 1
8	61622.XP_010378691.1	0.899	Belongs to the monovalent cation:proton antiporter 1 (CPA1) transporter (TC 2.A.36) family
9	61622.XP_010373379.1	0.898	Cell surface proteoglycan
10	61622.XP_010362610.1	0.886	Protein kinase C epsilon type isoform X1
11	61622.XP_010356677.1	0.885	CD44 molecule (Indian blood group)
12	61622.XP_010368074.1	0.875	Ras homolog family member A
13	61622.XP_010376658.1	0.875	Matrix metallopeptidase 14
14	61622.XP_010352612.1	0.853	Rho GDP-dissociation inhibitor 1
15	61622.XP_010364413.1	0.842	Leucine-rich repeat serine/threonine-protein kinase 2 isoform X1
16	61622.XP_010368974.1	0.832	PATJ, crumbs cell polarity complex component
17	61622.XP_010377964.1	0.815	Protein kinase which is a key regulator of actin cytoskeleton and cell polarity
18	61622.XP_010357352.1	0.807	Rho-related GTP-binding protein RhoC
19	61622.XP_010357355.1	0.807	Ras homolog family member C
20	61622.XP_010353190.1	0.804	Protein kinase which is a key regulator of actin cytoskeleton and cell polarity

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003779	1.000	actin binding
GO:0019904	0.447	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0065008	0.994	regulation of biological quality
GO:0110053	0.990	regulation of actin filament organization
GO:0050896	0.989	response to stimulus
GO:0031333	0.987	negative regulation of protein-containing complex assembly
GO:0043244	0.986	regulation of protein-containing complex disassembly
GO:1901879	0.980	regulation of protein depolymerization
GO:0043242	0.979	negative regulation of protein-containing complex disassembly
GO:0030837	0.979	negative regulation of actin filament polymerization
GO:0051693	0.965	actin filament capping
GO:0051179	0.944	localization
GO:0045176	0.931	apical protein localization
GO:0070848	0.923	response to growth factor
GO:0036119	0.912	response to platelet-derived growth factor
GO:0071363	0.897	cellular response to growth factor stimulus
GO:0036120	0.886	cellular response to platelet-derived growth factor stimulus
GO:0048518	0.752	positive regulation of biological process
GO:0048522	0.702	positive regulation of cellular process
GO:0048856	0.547	anatomical structure development
GO:0051716	0.448	cellular response to stimulus
GO:0032501	0.328	multicellular organismal process
GO:0042221	0.317	response to chemical
GO:0032879	0.306	regulation of localization
GO:0048583	0.305	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0120025	0.998	plasma membrane bounded cell projection
GO:0098590	0.998	plasma membrane region
GO:0070161	0.986	anchoring junction
GO:0005622	0.975	intracellular anatomical structure
GO:0043226	0.974	organelle
GO:0005737	0.968	cytoplasm
GO:0043229	0.959	intracellular organelle
GO:0098858	0.950	actin-based cell projection
GO:0043227	0.925	membrane-bounded organelle
GO:0005576	0.924	extracellular region
GO:0005829	0.909	cytosol
GO:0043232	0.899	intracellular non-membrane-bounded organelle
GO:0065010	0.886	extracellular membrane-bounded organelle
GO:0031982	0.881	vesicle
GO:1903561	0.851	extracellular vesicle
GO:0005902	0.847	microvillus
GO:0070062	0.826	extracellular exosome
GO:0005911	0.808	cell-cell junction
GO:0043231	0.793	intracellular membrane-bounded organelle
GO:0032153	0.741	cell division site
GO:0042383	0.736	sarcolemma
GO:0005856	0.721	cytoskeleton
GO:0030496	0.719	midbody
GO:0060187	0.715	cell pole
GO:0032154	0.706	cleavage furrow
GO:0005912	0.686	adherens junction
GO:0030315	0.646	T-tubule
GO:0051286	0.625	cell tip
GO:0005925	0.618	focal adhesion
GO:0045177	0.602	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]