StarFunc result for job id P35247

User Input

>input (375 residues)
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPR
GEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNT
GAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQH
LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAAL
QQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDRACGEKRLVVCEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35247	1.000	1.000	1.287E-51	375	1.000	1.000	P35247.pdb.gz	SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens OX=9606 GN=SFTPD PE=1 SV=3
2	PDB:1htnA	0.302	0.702	2.412E-10	156	0.133	0.321	1htnA.pdb.gz	Crystal structure of tetranectin, a trimeric plasminogen-binding protein with an alpha-helical coiled coil.
3	PDB:7wz8A	0.315	0.599	2.893E-10	180	0.088	0.183	7wz8A.pdb.gz
4	AFDB:P55068	0.275	0.120	5.280E-10	883	0.203	0.086	P55068.pdb.gz	PGCB_RAT Brevican core protein OS=Rattus norvegicus OX=10116 GN=Bcan PE=1 SV=2
5	PDB:1qddA	0.300	0.740	1.096E-9	144	0.075	0.194	1qddA.pdb.gz	Mechanism of calcite crystal growth inhibition by the N-terminal undecapeptide of lithostathine.
6	PDB:5f2qB	0.301	0.795	4.691E-9	135	0.069	0.193	5f2qB.pdb.gz	C-type lectin from Bothrops jararacussu
7	AFDB:F1R511	0.274	0.087	1.027E-8	1207	0.179	0.056	F1R511.pdb.gz
8	PDB:4mthA	0.287	0.722	3.462E-8	139	0.077	0.209	4mthA.pdb.gz	Antibacterial membrane attack by a pore-forming intestinal C-type lectin.
9	AFDB:Q61282	0.291	0.054	5.599E-8	2132	0.155	0.027	Q61282.pdb.gz	PGCA_MOUSE Aggrecan core protein OS=Mus musculus OX=10090 GN=Acan PE=1 SV=2
10	PDB:7jptA	0.287	0.084	1.235E-7	1327	0.069	0.020	7jptA.pdb.gz
11	PDB:7qsrA	0.290	0.085	1.776E-7	1335	0.061	0.017	7qsrA.pdb.gz
12	PDB:1bj3B	0.237	0.671	6.733E-7	123	0.091	0.276	1bj3B.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
13	PDB:1bj3A	0.232	0.627	8.579E-7	129	0.088	0.256	1bj3A.pdb.gz	Crystal structure of coagulation factor IX-binding protein from habu snake venom at 2.6 A: implication of central loop swapping based on deletion in the linker region.
14	PDB:1gz2A	0.288	0.725	1.311E-6	139	0.061	0.165	1gz2A.pdb.gz
15	AFDB:Q99941	0.104	0.063	3.861	703	0.109	0.058	Q99941.pdb.gz	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
16	AFDB:Q9ZUE0	0.098	0.059	3.861	720	0.120	0.062	Q9ZUE0.pdb.gz	PEK12_ARATH Proline-rich receptor-like protein kinase PERK12 OS=Arabidopsis thaliana OX=3702 GN=PERK12 PE=2 SV=2
17	AFDB:Q7Z4V5	0.123	0.078	4.631	671	0.104	0.058	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
18	AFDB:Q6P9K9	0.091	0.026	4.920	1571	0.088	0.021	Q6P9K9.pdb.gz	NRX3A_MOUSE Neurexin-3 OS=Mus musculus OX=10090 GN=Nrxn3 PE=1 SV=2
19	AFDB:Q8N5C8	0.101	0.062	4.920	712	0.117	0.062	Q8N5C8.pdb.gz	TAB3_HUMAN TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3
20	AFDB:O35817	0.107	0.086	5.553	502	0.125	0.094	O35817.pdb.gz	AKA14_RAT A-kinase anchor protein 14 OS=Rattus norvegicus OX=10116 GN=Akap14 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35247	0.0	734	375	1.000	1.000	SFTPD_HUMAN Pulmonary surfactant-associated protein D OS=Homo sapiens OX=9606 GN=SFTPD PE=1 SV=3
2	P35248	0.0	524	374	0.749	0.751	SFTPD_RAT Pulmonary surfactant-associated protein D OS=Rattus norvegicus OX=10116 GN=Sftpd PE=1 SV=1
3	P50404	4.69e-177	498	374	0.747	0.749	SFTPD_MOUSE Pulmonary surfactant-associated protein D OS=Mus musculus OX=10090 GN=Sftpd PE=1 SV=1
4	Q98TA4	1.80e-48	166	254	0.259	0.382	MBL_CHICK Mannose-binding protein OS=Gallus gallus OX=9031 GN=MBL PE=2 SV=2
5	P19999	2.76e-41	147	238	0.235	0.370	MBL1_RAT Mannose-binding protein A OS=Rattus norvegicus OX=10116 GN=Mbl1 PE=1 SV=1
6	P39039	8.33e-40	143	239	0.229	0.360	MBL1_MOUSE Mannose-binding protein A OS=Mus musculus OX=10090 GN=Mbl1 PE=1 SV=1
7	P08661	3.64e-38	139	244	0.245	0.377	MBL2_RAT Mannose-binding protein C OS=Rattus norvegicus OX=10116 GN=Mbl2 PE=1 SV=2
8	P08427	7.04e-37	135	248	0.240	0.363	SFTPA_RAT Pulmonary surfactant-associated protein A OS=Rattus norvegicus OX=10116 GN=Sftpa1 PE=1 SV=3
9	P11226	2.18e-36	134	248	0.256	0.387	MBL2_HUMAN Mannose-binding protein C OS=Homo sapiens OX=9606 GN=MBL2 PE=1 SV=2
10	P35242	1.55e-35	132	248	0.232	0.351	SFTPA_MOUSE Pulmonary surfactant-associated protein A OS=Mus musculus OX=10090 GN=Sftpa1 PE=1 SV=1
11	Q5U3G1	2.07e-35	132	271	0.248	0.343	COL11_DANRE Collectin-11 OS=Danio rerio OX=7955 GN=colec11 PE=2 SV=1
12	P41317	8.10e-35	130	244	0.235	0.361	MBL2_MOUSE Mannose-binding protein C OS=Mus musculus OX=10090 GN=Mbl2 PE=1 SV=2
13	Q8IWL2	6.71e-33	125	248	0.229	0.347	SFTA1_HUMAN Pulmonary surfactant-associated protein A1 OS=Homo sapiens OX=9606 GN=SFTPA1 PE=1 SV=2
14	Q8IWL1	6.53e-32	122	248	0.229	0.347	SFPA2_HUMAN Pulmonary surfactant-associated protein A2 OS=Homo sapiens OX=9606 GN=SFTPA2 PE=1 SV=2
15	Q9BWP8	3.41e-27	110	271	0.216	0.299	COL11_HUMAN Collectin-11 OS=Homo sapiens OX=9606 GN=COLEC11 PE=1 SV=1
16	Q9Y6Z7	4.89e-27	110	277	0.232	0.314	COL10_HUMAN Collectin-10 OS=Homo sapiens OX=9606 GN=COLEC10 PE=1 SV=2
17	Q8CF98	3.21e-26	108	277	0.224	0.303	COL10_MOUSE Collectin-10 OS=Mus musculus OX=10090 GN=Colec10 PE=2 SV=1
18	Q3SXB8	2.23e-25	105	272	0.219	0.301	COL11_MOUSE Collectin-11 OS=Mus musculus OX=10090 GN=Colec11 PE=2 SV=2
19	Q9UEW3	1.77e-24	106	520	0.232	0.167	MARCO_HUMAN Macrophage receptor MARCO OS=Homo sapiens OX=9606 GN=MARCO PE=1 SV=1
20	Q4ZJM7	4.22e-24	105	482	0.232	0.180	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01391 Collagen	1.7e-26	103.1	Collagen triple helix repeat (20 copies)
2	PF16355 DUF4982	0.58	21.4	Domain of unknown function (DUF4982)
3	PF00059 Lectin_C	1.1e-19	82.5	Lectin C-type domain
4	PF04728 LPP	5.9e+02	12.1	Lipoprotein leucine-zipper
5	PF05531 NPV_P10	5.7e+02	12.4	Nucleopolyhedrovirus P10 protein
6	PF09006 Surfac_D-trimer	1.3e-25	100.3	Lung surfactant protein D coiled-coil trimerisation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361366

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357905	0.994	Deleted in malignant brain tumors 1 protein
2	9606.ENSP00000382941	0.987	Tyrosine-protein phosphatase non-receptor type substrate 1
3	9606.ENSP00000378957	0.975	Microfibril-associated glycoprotein 4
4	9606.ENSP00000375622	0.959	Leukocyte-associated immunoglobulin-like receptor 1
5	9606.ENSP00000320866	0.956	Calreticulin
6	9606.ENSP00000386346	0.956	Pulmonary surfactant-associated protein B
7	9606.ENSP00000363089	0.940	Toll-like receptor 4
8	9606.ENSP00000316152	0.932	Pulmonary surfactant-associated protein C
9	9606.ENSP00000243077	0.812	Prolow-density lipoprotein receptor-related protein 1
10	9606.ENSP00000397082	0.779	Pulmonary surfactant-associated protein A1
11	9606.ENSP00000484824	0.769	Mucin-1
12	9606.ENSP00000278282	0.767	Uteroglobin
13	9606.ENSP00000359663	0.725	CD40 ligand
14	9606.ENSP00000361400	0.716	Pulmonary surfactant-associated protein A2
15	9606.ENSP00000364210	0.712	Advanced glycosylation end product-specific receptor
16	9606.ENSP00000275493	0.708	Epidermal growth factor receptor
17	9606.ENSP00000284818	0.708	Lymphocyte antigen 96
18	9606.ENSP00000354003	0.708	Glycophorin-A
19	9606.ENSP00000385478	0.690	D-ribitol-5-phosphate cytidylyltransferase
20	9606.ENSP00000052754	0.666	Decorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030246	1.000	carbohydrate binding
GO:0005515	1.000	protein binding
GO:0048029	0.306	monosaccharide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0050896	0.982	response to stimulus
GO:0050794	0.970	regulation of cellular process
GO:0032501	0.934	multicellular organismal process
GO:0019222	0.924	regulation of metabolic process
GO:0048856	0.922	anatomical structure development
GO:0048518	0.891	positive regulation of biological process
GO:0001817	0.880	regulation of cytokine production
GO:0048519	0.829	negative regulation of biological process
GO:0051716	0.822	cellular response to stimulus
GO:0030155	0.815	regulation of cell adhesion
GO:0048523	0.804	negative regulation of cellular process
GO:0050764	0.801	regulation of phagocytosis
GO:0051241	0.793	negative regulation of multicellular organismal process
GO:0009607	0.791	response to biotic stimulus
GO:0006955	0.787	immune response
GO:0070663	0.785	regulation of leukocyte proliferation
GO:0006950	0.777	response to stress
GO:0051249	0.777	regulation of lymphocyte activation
GO:1903037	0.771	regulation of leukocyte cell-cell adhesion
GO:0006952	0.770	defense response
GO:0009605	0.751	response to external stimulus
GO:0032944	0.750	regulation of mononuclear cell proliferation
GO:0051050	0.732	positive regulation of transport
GO:0006959	0.701	humoral immune response
GO:0008152	0.690	metabolic process
GO:0042221	0.674	response to chemical
GO:0044419	0.672	biological process involved in interspecies interaction between organisms
GO:0002683	0.669	negative regulation of immune system process
GO:0050766	0.668	positive regulation of phagocytosis
GO:0007162	0.662	negative regulation of cell adhesion
GO:0051707	0.637	response to other organism
GO:0050863	0.637	regulation of T cell activation
GO:0050670	0.621	regulation of lymphocyte proliferation
GO:0032945	0.616	negative regulation of mononuclear cell proliferation
GO:0051179	0.606	localization
GO:0051250	0.590	negative regulation of lymphocyte activation
GO:1903038	0.570	negative regulation of leukocyte cell-cell adhesion
GO:0042129	0.558	regulation of T cell proliferation
GO:0070887	0.536	cellular response to chemical stimulus
GO:0010033	0.506	response to organic substance
GO:0048522	0.486	positive regulation of cellular process
GO:0009892	0.476	negative regulation of metabolic process
GO:0007275	0.438	multicellular organism development
GO:0048878	0.435	chemical homeostasis
GO:0010605	0.435	negative regulation of macromolecule metabolic process
GO:0140962	0.426	multicellular organismal-level chemical homeostasis
GO:0071704	0.424	organic substance metabolic process
GO:0048583	0.424	regulation of response to stimulus
GO:0050868	0.424	negative regulation of T cell activation
GO:0050672	0.424	negative regulation of lymphocyte proliferation
GO:0042130	0.412	negative regulation of T cell proliferation
GO:0032663	0.406	regulation of interleukin-2 production
GO:0098542	0.401	defense response to other organism
GO:0009617	0.396	response to bacterium
GO:0044237	0.348	cellular metabolic process
GO:0006810	0.326	transport
GO:0031323	0.317	regulation of cellular metabolic process
GO:0080090	0.308	regulation of primary metabolic process
GO:0051171	0.308	regulation of nitrogen compound metabolic process
GO:0009893	0.308	positive regulation of metabolic process
GO:0007154	0.306	cell communication
GO:0010604	0.304	positive regulation of macromolecule metabolic process
GO:0044238	0.302	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0031982	0.997	vesicle
GO:0071944	0.994	cell periphery
GO:0016020	0.990	membrane
GO:0031410	0.988	cytoplasmic vesicle
GO:0031090	0.960	organelle membrane
GO:0005615	0.941	extracellular space
GO:0005783	0.917	endoplasmic reticulum
GO:0005886	0.905	plasma membrane
GO:0099503	0.703	secretory vesicle
GO:0030141	0.673	secretory granule
GO:0030312	0.644	external encapsulating structure
GO:0031012	0.598	extracellular matrix
GO:0032991	0.572	protein-containing complex
GO:0062023	0.565	collagen-containing extracellular matrix
GO:0098588	0.555	bounding membrane of organelle
GO:0005789	0.497	endoplasmic reticulum membrane
GO:0070013	0.493	intracellular organelle lumen
GO:0030139	0.485	endocytic vesicle
GO:0030659	0.462	cytoplasmic vesicle membrane
GO:0005764	0.461	lysosome
GO:0030136	0.446	clathrin-coated vesicle
GO:0045334	0.432	clathrin-coated endocytic vesicle
GO:0065010	0.318	extracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]