StarFunc result for job id P35249

User Input

>input (363 residues)
MQAFLKGTSISTKPPLTKDRGVAASAGSSGENKKAKPVPWVEKYRPKCVDEVAFQEEVVA
VLKKSLEGADLPNLLFYGPPGTGKTSTILAAARELFGPELFRLRVLELNASDERGIQVVR
EKVKNFAQLTVSGSRSDGKPCPPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLIC
NYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLVKVSEGDLRK
AITFLQSATRLTGGKEITEKVITDIAGVIPAEKIDGVFAACQSGSFDKLEAVVKDLIDEG
HAATQLVNQLHDVVVENNLSDKQKSIITEKLAEVDKCLADGADEHLQLISLCATVMQQLS
QNC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q99J62	0.969	0.966	2.577E-52	364	0.912	0.909	Q99J62.pdb.gz	RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus OX=10090 GN=Rfc4 PE=1 SV=1
2	AFDB:Q5ZHL1	0.918	0.928	5.498E-48	359	0.829	0.838	Q5ZHL1.pdb.gz	Q5ZHL1_CHICK AAA+ ATPase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_37a17 PE=2 SV=1
3	AFDB:C9JZI1	0.841	0.908	1.341E-45	336	0.917	0.991	C9JZI1.pdb.gz	C9JZI1_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=1
4	AFDB:A0A0R4IAU3	0.946	0.959	1.204E-42	358	0.686	0.696	A0A0R4IAU3.pdb.gz
5	PDB:7z6hD	0.823	0.915	7.087E-41	324	0.893	1.000	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
6	AFDB:Q9VX15	0.885	0.910	4.933E-38	353	0.532	0.547	Q9VX15.pdb.gz	Q9VX15_DROME LD35209p OS=Drosophila melanogaster OX=7227 GN=Rfc37 PE=1 SV=2
7	AFDB:Q09843	0.880	0.938	5.201E-36	340	0.490	0.524	Q09843.pdb.gz	RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc2 PE=1 SV=1
8	AFDB:P40348	0.842	0.865	1.793E-34	353	0.471	0.484	P40348.pdb.gz	RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC2 PE=1 SV=1
9	AFDB:Q585Y7	0.866	0.905	1.210E-33	347	0.435	0.455	Q585Y7.pdb.gz	Q585Y7_TRYB2 Replication factor C, subunit 2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.530 PE=3 SV=1
10	AFDB:F4HY43	0.866	0.921	1.302E-32	341	0.482	0.513	F4HY43.pdb.gz	F4HY43_ARATH ATPase family associated with various cellular activities (AAA) OS=Arabidopsis thaliana OX=3702 GN=EMB1968 PE=1 SV=1
11	PDB:8dr0D	0.814	0.856	2.391E-31	344	0.477	0.503	8dr0D.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
12	AFDB:Q503Q7	0.845	0.916	2.306E-28	334	0.347	0.377	Q503Q7.pdb.gz
13	PDB:8dqxC	0.774	0.845	3.376E-25	330	0.320	0.352	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
14	PDB:6vvoB	0.732	0.828	4.464E-25	316	0.322	0.370	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
15	PDB:7tfhB	0.712	0.796	4.288E-23	320	0.306	0.347	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
16	PDB:7z6hG	0.740	0.837	5.304E-22	317	0.331	0.379	7z6hG.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
17	PDB:8dqwE	0.624	0.639	9.091E-21	354	0.281	0.288	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
18	PDB:1sxjE	0.604	0.680	1.676E-18	317	0.275	0.315	1sxjE.pdb.gz	Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex.
19	PDB:6vvoE	0.607	0.631	4.796E-17	346	0.242	0.254	6vvoE.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
20	PDB:3u5zB	0.637	0.712	1.169E-14	320	0.218	0.247	3u5zB.pdb.gz	How a DNA polymerase clamp loader opens a sliding clamp.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JZI1	0.0	671	336	0.926	1.000	C9JZI1_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=1
2	P35249	0.0	740	363	1.000	1.000	RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens OX=9606 GN=RFC4 PE=1 SV=2
3	Q5ZHL1	0.0	614	359	0.829	0.838	Q5ZHL1_CHICK AAA+ ATPase domain-containing protein OS=Gallus gallus OX=9031 GN=RCJMB04_37a17 PE=2 SV=1
4	Q6DRF4	0.0	553	358	0.738	0.749	Q6DRF4_DANRE Replication factor C subunit 4 OS=Danio rerio OX=7955 GN=zgc:64030 PE=1 SV=1
5	Q99J62	0.0	683	364	0.912	0.909	RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus OX=10090 GN=Rfc4 PE=1 SV=1
6	Q93ZX1	1.19e-130	379	339	0.507	0.543	RFC4_ARATH Replication factor C subunit 4 OS=Arabidopsis thaliana OX=3702 GN=RFC4 PE=1 SV=1
7	Q9VX15	1.61e-127	372	353	0.532	0.547	Q9VX15_DROME LD35209p OS=Drosophila melanogaster OX=7227 GN=Rfc37 PE=1 SV=2
8	F4HY43	5.29e-122	357	341	0.477	0.507	F4HY43_ARATH ATPase family associated with various cellular activities (AAA) OS=Arabidopsis thaliana OX=3702 GN=EMB1968 PE=1 SV=1
9	Q09843	1.75e-119	350	340	0.485	0.518	RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc2 PE=1 SV=1
10	P40348	2.25e-117	346	353	0.479	0.493	RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC2 PE=1 SV=1
11	Q585Y7	3.68e-106	317	347	0.441	0.461	Q585Y7_TRYB2 Replication factor C, subunit 2, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.530 PE=3 SV=1
12	P53016	6.63e-80	249	334	0.380	0.413	RFC4_CAEEL Replication factor C subunit 4 OS=Caenorhabditis elegans OX=6239 GN=rfc-4 PE=1 SV=1
13	Q38DH5	6.17e-77	243	357	0.364	0.370	Q38DH5_TRYB2 Replication factor C, subunit 3, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3310 PE=3 SV=1
14	Q9VKW3	2.96e-74	235	332	0.361	0.395	Q9VKW3_DROME Replication factor C subunit 3 OS=Drosophila melanogaster OX=7227 GN=RfC3 PE=1 SV=2
15	Q6DRK4	2.99e-73	232	334	0.361	0.392	Q6DRK4_DANRE Replication factor C (activator 1) 5 OS=Danio rerio OX=7955 GN=zgc:110313 PE=1 SV=1
16	Q9D0F6	6.79e-72	229	339	0.355	0.381	RFC5_MOUSE Replication factor C subunit 5 OS=Mus musculus OX=10090 GN=Rfc5 PE=1 SV=1
17	P40937	4.00e-71	227	340	0.350	0.374	RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5 PE=1 SV=1
18	Q9CAQ8	2.30e-70	226	369	0.375	0.369	RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana OX=3702 GN=RFC5 PE=1 SV=1
19	O94449	4.34e-69	222	342	0.361	0.383	RFC4_SCHPO Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc4 PE=1 SV=1
20	P38629	7.40e-68	219	340	0.333	0.356	RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	3.3e-14	64.9	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	1.5	20.1	AAA domain
3	PF13191 AAA_16	0.023	26.5	AAA ATPase domain
4	PF13245 AAA_19	3.6	19.2	AAA domain
5	PF13401 AAA_22	3	19.6	AAA domain
6	PF13476 AAA_23	1.7e+02	14.1	AAA domain
7	PF13479 AAA_24	2.7	19.2	AAA domain
8	PF13521 AAA_28	3.3e+02	12.9	AAA domain
9	PF13604 AAA_30	2.2	19.5	AAA domain
10	PF07728 AAA_5	1e+02	14.3	AAA domain (dynein-related subfamily)
11	PF12775 AAA_7	3.8e+02	12.0	P-loop containing dynein motor region
12	PF16193 AAA_assoc_2	0.029	26.0	AAA C-terminal domain
13	PF00270 DEAD	1.8e+02	13.3	DEAD/DEAH box helicase
14	PF06144 DNA_pol3_delta	3.9	18.7	DNA polymerase III, delta subunit
15	PF13177 DNA_pol3_delta2	3.8e-07	41.8	DNA polymerase III, delta subunit
16	PF09848 DUF2075	54	14.5	Schlafen group 3, DNA/RNA helicase domain
17	PF19591 DUF6096	3.9e+02	12.7	Family of unknown function (DUF6096)
18	PF05673 DUF815	0.49	21.0	Protein of unknown function (DUF815)
19	PF01078 Mg_chelatase	16	16.4	Magnesium chelatase, subunit ChlI
20	PF03215 Rad17	0.0052	28.2	Rad17 P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376272

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000055077	0.999	Replication factor C subunit 2
2	9606.ENSP00000262315	0.999	Chromosome transmission fidelity protein 18 homolog
3	9606.ENSP00000313171	0.999	ATPase family AAA domain-containing protein 5
4	9606.ENSP00000322180	0.999	Sister chromatid cohesion protein DCC1
5	9606.ENSP00000368458	0.999	Proliferating cell nuclear antigen
6	9606.ENSP00000369411	0.999	Replication factor C subunit 3
7	9606.ENSP00000371321	0.999	Replication factor C subunit 1
8	9606.ENSP00000408295	0.999	Replication factor C subunit 5
9	9606.ENSP00000426191	0.999	Cell cycle checkpoint protein RAD17
10	9606.ENSP00000307288	0.998	DNA replication licensing factor MCM7
11	9606.ENSP00000265056	0.997	DNA replication licensing factor MCM2
12	9606.ENSP00000480987	0.997	DNA replication licensing factor MCM3
13	9606.ENSP00000350491	0.996	DNA primase small subunit
14	9606.ENSP00000209728	0.993	Cell division control protein 6 homolog
15	9606.ENSP00000262105	0.991	DNA replication licensing factor MCM4
16	9606.ENSP00000388648	0.991	Serine/threonine-protein kinase Chk1
17	9606.ENSP00000254719	0.990	Replication protein A 70 kDa DNA-binding subunit
18	9606.ENSP00000260810	0.988	DNA topoisomerase 2-binding protein 1
19	9606.ENSP00000378699	0.987	Cyclin-dependent kinase 1
20	9606.ENSP00000261881	0.986	TIMELESS-interacting protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003678	0.996	DNA helicase activity
GO:0019899	0.995	enzyme binding
GO:0017116	0.985	single-stranded DNA helicase activity
GO:0097159	0.423	organic cyclic compound binding
GO:1901363	0.417	heterocyclic compound binding
GO:0003689	0.367	DNA clamp loader activity
GO:0003676	0.351	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.979	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0044237	0.978	cellular metabolic process
GO:0006807	0.974	nitrogen compound metabolic process
GO:0043170	0.964	macromolecule metabolic process
GO:0050794	0.956	regulation of cellular process
GO:0034641	0.955	cellular nitrogen compound metabolic process
GO:0044260	0.953	cellular macromolecule metabolic process
GO:0090304	0.950	nucleic acid metabolic process
GO:0006259	0.938	DNA metabolic process
GO:0019222	0.905	regulation of metabolic process
GO:0051052	0.869	regulation of DNA metabolic process
GO:2000278	0.828	regulation of DNA biosynthetic process
GO:0048518	0.821	positive regulation of biological process
GO:0048522	0.786	positive regulation of cellular process
GO:0051347	0.781	positive regulation of transferase activity
GO:2000573	0.772	positive regulation of DNA biosynthetic process
GO:0006260	0.768	DNA replication
GO:0006275	0.761	regulation of DNA replication
GO:0022616	0.442	DNA strand elongation
GO:0090329	0.399	regulation of DNA-templated DNA replication
GO:0006261	0.386	DNA-templated DNA replication
GO:0050896	0.379	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0005654	1.000	nucleoplasm
GO:0005694	0.990	chromosome
GO:0032991	0.979	protein-containing complex
GO:0140513	0.809	nuclear protein-containing complex
GO:1902494	0.742	catalytic complex
GO:0005657	0.466	replication fork

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]