StarFunc result for job id P35251

User Input

>input (1148 residues)
MDIRKFFGVIPSGKKLVSETVKKNEKTKSDEETLKAKKGIKEIKVNSSRKEDDFKQKQPS
KKKRIIYDSDSESEETLQVKNAKKPPEKLPVSSKPGKISRQDPVTYISETDEEDDFMCKK
AASKSKENGRSTNSHLGTSNMKKNEENTKTKNKPLSPIKLTPTSVLDYFGTGSVQRSNKK
MVASKRKELSQNTDESGLNDEAIAKQLQLDEDAELERQLHEDEEFARTLAMLDEEPKTKK
ARKDTEAGETFSSVQANLSKAEKHKYPHKVKTAQVSDERKSYSPRKQSKYESSKESQQHS
KSSADKIGEVSSPKASSKLAIMKRKEESSYKEIEPVASKRKENAIKLKGETKTPKKTKSS
PAKKESVSPEDSEKKRTNYQAYRSYLNREGPKALGSKEIPKGAENCLEGLIFVITGVLES
IERDEAKSLIERYGGKVTGNVSKKTNYLVMGRDSGQSKSDKAAALGTKIIDEDGLLNLIR
TMPGKKSKYEIAVETEMKKESKLERTPQKNVQGKRKISPSKKESESKKSRPTSKRDSLAK
TIKKETDVFWKSLDFKEQVAEETSGDSKARNLADDSSENKVENLLWVDKYKPTSLKTIIG
QQGDQSCANKLLRWLRNWQKSSSEDKKHAAKFGKFSGKDDGSSFKAALLSGPPGVGKTTT
ASLVCQELGYSYVELNASDTRSKSSLKAIVAESLNNTSIKGFYSNGAASSVSTKHALIMD
EVDGMAGNEDRGGIQELIGLIKHTKIPIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQI
KGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHNLSMWCARSKALTYDQAKADSHRA
KKDIKMGPFDVARKVFAAGEETAHMSLVDKSDLFFHDYSIAPLFVQENYIHVKPVAAGGD
MKKHLMLLSRAADSICDGDLVDSQIRSKQNWSLLPAQAIYASVLPGELMRGYMTQFPTFP
SWLGKHSSTGKHDRIVQDLALHMSLRTYSSKRTVNMDYLSLLRDALVQPLTSQGVDGVQD
VVALMDTYYLMKEDFENIMEISSWGGKPSPFSKLDPKVKAAFTRAYNKEAHLTPYSLQAI
KASRHSTSPSLDSEYNEELNEDDSQSDEKDQDAIETDAMIKKKTKSSKPSKPEKDKEPRK
GKGKSSKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35251	0.999	0.999	0.000	1148	1.000	1.000	P35251.pdb.gz	RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4
2	PDB:8dr5A	0.407	0.681	4.165E-46	646	0.207	0.368	8dr5A.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
3	AFDB:O88461	0.131	0.219	2.830E-44	656	0.386	0.675	O88461.pdb.gz	O88461_RAT VIP-receptor-gene repressor protein OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=2 SV=1
4	PDB:7tfkA	0.288	0.860	3.806E-24	360	0.125	0.400	7tfkA.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
5	AFDB:A0A0D9SF58	0.340	0.330	1.853E-21	1184	0.162	0.157	A0A0D9SF58.pdb.gz	A0A0D9SF58_HUMAN Chromosome transmission fidelity factor 18 OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1
6	AFDB:Q96QE3	0.183	0.122	1.958E-12	1844	0.174	0.108	Q96QE3.pdb.gz	ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5 PE=1 SV=4
7	PDB:6vvoB	0.179	0.563	7.603E-11	316	0.062	0.225	6vvoB.pdb.gz	Structure of the human clamp loader bound to the sliding clamp: a further twist on AAA+ mechanism
8	PDB:7tfhB	0.203	0.617	2.359E-10	320	0.064	0.228	7tfhB.pdb.gz	Cryo-EM structures reveal that RFC recognizes both the 3'- and 5'-DNA ends to load PCNA onto gaps for DNA repair.
9	PDB:8dqxC	0.191	0.553	3.018E-10	330	0.068	0.236	8dqxC.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
10	PDB:7z6hK	0.265	0.625	4.938E-10	439	0.066	0.173	7z6hK.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
11	AFDB:O64728	0.182	0.174	2.237E-9	1218	0.103	0.097	O64728.pdb.gz	STI_ARATH Protein STICHEL OS=Arabidopsis thaliana OX=3702 GN=STI PE=1 SV=2
12	PDB:8dqwE	0.194	0.522	3.717E-9	354	0.059	0.192	8dqwE.pdb.gz	Multistep loading of a DNA sliding clamp onto DNA by replication factor C.
13	PDB:7z6hD	0.192	0.591	4.102E-9	324	0.057	0.201	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
14	PDB:7st9A	0.277	0.559	7.407E-9	522	0.078	0.170	7st9A.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
15	PDB:7steA	0.143	0.320	9.952E-9	468	0.064	0.158	7steA.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
16	AFDB:Q9Y794	0.126	0.145	3.607E-6	972	0.110	0.130	Q9Y794.pdb.gz	ORC4_SCHPO Origin recognition complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=orc4 PE=1 SV=1
17	AFDB:Q9VIQ9	0.111	0.065	1.896E-2	2197	0.131	0.068	Q9VIQ9.pdb.gz	SICK_DROME Protein sickie OS=Drosophila melanogaster OX=7227 GN=sick PE=3 SV=3
18	AFDB:F4HTG1	0.052	0.048	5.884E-2	1280	0.096	0.086	F4HTG1.pdb.gz	F4HTG1_ARATH SNF2 domain-containing protein / helicase domain-containing protein / zinc finger protein-like protein OS=Arabidopsis thaliana OX=3702 GN=EDA16 PE=1 SV=1
19	AFDB:Q7TT79	0.054	0.074	1.231E-1	822	0.057	0.079	Q7TT79.pdb.gz	MCPH1_MOUSE Microcephalin OS=Mus musculus OX=10090 GN=Mcph1 PE=1 SV=1
20	AFDB:Q8IVL0	0.095	0.057	1.738E-1	2385	0.106	0.051	Q8IVL0.pdb.gz	NAV3_HUMAN Neuron navigator 3 OS=Homo sapiens OX=9606 GN=NAV3 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVK8	0.0	1832	1127	0.794	0.809	A0A0G2JVK8_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=2
2	D3ZFT1	0.0	1822	1145	0.794	0.797	D3ZFT1_RAT Replication factor C subunit 1 OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=1 SV=3
3	O88461	0.0	788	656	0.383	0.671	O88461_RAT VIP-receptor-gene repressor protein OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=2 SV=1
4	P35251	0.0	2354	1148	1.000	1.000	RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=4
5	P35600	0.0	657	986	0.322	0.375	RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster OX=7227 GN=Gnf1 PE=1 SV=2
6	P35601	0.0	1850	1131	0.813	0.825	RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus OX=10090 GN=Rfc1 PE=1 SV=2
7	Q9Z2R7	0.0	1563	1104	0.723	0.752	Q9Z2R7_RAT Replication factor C subunit 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Rfc1 PE=2 SV=1
8	P38630	1.36e-130	421	861	0.232	0.309	RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RFC1 PE=1 SV=1
9	Q9C587	1.39e-116	386	956	0.222	0.267	RFC1_ARATH Replication factor C subunit 1 OS=Arabidopsis thaliana OX=3702 GN=RFC1 PE=2 SV=1
10	O60182	1.78e-99	339	934	0.171	0.210	RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rfc1 PE=1 SV=1
11	Q385K3	1.24e-77	269	587	0.147	0.288	Q385K3_TRYB2 Replication factor C, subunit 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3360 PE=3 SV=1
12	H0Y9P8	7.99e-61	204	101	0.084	0.960	H0Y9P8_HUMAN Replication factor C subunit 1 (Fragment) OS=Homo sapiens OX=9606 GN=RFC1 PE=1 SV=1
13	Q8IQ05	3.19e-22	106	993	0.097	0.112	CTF18_DROME Chromosome transmission fidelity protein 18 homolog OS=Drosophila melanogaster OX=7227 GN=cutlet PE=2 SV=2
14	Q57Y55	1.37e-21	103	993	0.072	0.084	Q57Y55_TRYB2 AAA+ ATPase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.550 PE=4 SV=1
15	Q9USQ1	7.36e-19	95.1	960	0.059	0.071	CTF18_SCHPO Chromosome transmission fidelity protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ctf18 PE=1 SV=1
16	P49956	1.82e-18	93.6	741	0.064	0.099	CTF18_YEAST Chromosome transmission fidelity protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CTF18 PE=1 SV=1
17	Q8BIW9	4.56e-18	92.4	969	0.057	0.067	CTF18_MOUSE Chromosome transmission fidelity protein 18 homolog OS=Mus musculus OX=10090 GN=Chtf18 PE=1 SV=2
18	F4I5S3	1.31e-17	91.3	943	0.071	0.086	F4I5S3_ARATH P-loop containing nucleoside triphosphate hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=CTF18 PE=1 SV=1
19	Q8WVB6	2.74e-17	90.1	975	0.056	0.066	CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=1
20	E7EXA6	2.79e-17	90.1	975	0.056	0.066	E7EXA6_HUMAN Chromosome transmission fidelity factor 18 OS=Homo sapiens OX=9606 GN=CHTF18 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	4.6e-11	54.7	ATPase family associated with various cellular activities (AAA)
2	PF13173 AAA_14	13	17.2	AAA domain
3	PF13191 AAA_16	2.8	19.8	AAA ATPase domain
4	PF13207 AAA_17	61	15.5	AAA domain
5	PF13238 AAA_18	64	15.5	AAA domain
6	PF13401 AAA_22	4.1	19.1	AAA domain
7	PF13671 AAA_33	5.4	18.6	AAA domain
8	PF07728 AAA_5	3	19.3	AAA domain (dynein-related subfamily)
9	PF12775 AAA_7	84	14.1	P-loop containing dynein motor region
10	PF00533 BRCT	2.1e-14	65.0	BRCA1 C Terminus (BRCT) domain
11	PF16589 BRCT_2	29	16.5	BRCT domain, a BRCA1 C-terminus domain
12	PF10078 DUF2316	3.6e+02	12.8	Uncharacterized protein conserved in bacteria (DUF2316)
13	PF03266 NTPase_1	92	14.3	NTPase
14	PF12738 PTCB-BRCT	0.035	25.4	twin BRCT domain
15	PF03215 Rad17	0.83	21.1	Rad17 P-loop domain
16	PF08519 RFC1	3.4e-54	194.8	Replication factor RFC1 C terminal domain
17	PF00910 RNA_helicase	76	15.1	RNA helicase
18	PF05496 RuvB_N	1.1	20.4	Holliday junction DNA helicase RuvB P-loop domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371321

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000055077	0.999	Replication factor C subunit 2
2	9606.ENSP00000368458	0.999	Proliferating cell nuclear antigen
3	9606.ENSP00000369411	0.999	Replication factor C subunit 3
4	9606.ENSP00000376272	0.999	Replication factor C subunit 4
5	9606.ENSP00000408295	0.999	Replication factor C subunit 5
6	9606.ENSP00000426191	0.980	Cell cycle checkpoint protein RAD17
7	9606.ENSP00000347232	0.975	Bloom syndrome protein
8	9606.ENSP00000278616	0.972	Serine-protein kinase ATM
9	9606.ENSP00000262315	0.971	Chromosome transmission fidelity protein 18 homolog
10	9606.ENSP00000313171	0.962	ATPase family AAA domain-containing protein 5
11	9606.ENSP00000368100	0.958	DNA repair protein RAD50
12	9606.ENSP00000265433	0.957	Nibrin
13	9606.ENSP00000325863	0.956	Double-strand break repair protein MRE11
14	9606.ENSP00000355506	0.954	Exonuclease 1
15	9606.ENSP00000368349	0.954	DNA polymerase alpha catalytic subunit
16	9606.ENSP00000351185	0.953	DNA replication ATP-dependent helicase/nuclease DNA2
17	9606.ENSP00000372088	0.953	DNA repair protein RAD51 homolog 1
18	9606.ENSP00000298139	0.952	Werner syndrome ATP-dependent helicase
19	9606.ENSP00000418960	0.952	Breast cancer type 1 susceptibility protein
20	9606.ENSP00000322570	0.949	DNA polymerase epsilon catalytic subunit A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1901363	1.000	heterocyclic compound binding
GO:0097159	1.000	organic cyclic compound binding
GO:0005515	1.000	protein binding
GO:0140657	0.997	ATP-dependent activity
GO:0140097	0.995	catalytic activity, acting on DNA
GO:0008094	0.988	ATP-dependent activity, acting on DNA
GO:0017076	0.988	purine nucleotide binding
GO:0043168	0.986	anion binding
GO:0003677	0.963	DNA binding
GO:0035639	0.953	purine ribonucleoside triphosphate binding
GO:0005524	0.928	ATP binding
GO:0008047	0.906	enzyme activator activity
GO:0003690	0.808	double-stranded DNA binding
GO:0061860	0.795	DNA clamp unloader activity
GO:0043565	0.742	sequence-specific DNA binding
GO:0019904	0.499	protein domain specific binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.970	organic substance metabolic process
GO:0044238	0.968	primary metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0006807	0.954	nitrogen compound metabolic process
GO:0043170	0.940	macromolecule metabolic process
GO:0050789	0.939	regulation of biological process
GO:0071840	0.931	cellular component organization or biogenesis
GO:0050794	0.929	regulation of cellular process
GO:0006259	0.915	DNA metabolic process
GO:0016043	0.906	cellular component organization
GO:0006260	0.904	DNA replication
GO:0000723	0.897	telomere maintenance
GO:0071897	0.883	DNA biosynthetic process
GO:0010833	0.804	telomere maintenance via telomere lengthening
GO:0006278	0.790	RNA-templated DNA biosynthetic process
GO:0019222	0.750	regulation of metabolic process
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0080090	0.734	regulation of primary metabolic process
GO:0051171	0.734	regulation of nitrogen compound metabolic process
GO:0031323	0.727	regulation of cellular metabolic process
GO:0007004	0.642	telomere maintenance via telomerase
GO:0048518	0.602	positive regulation of biological process
GO:0019219	0.594	regulation of nucleobase-containing compound metabolic process
GO:0006261	0.584	DNA-templated DNA replication
GO:0048523	0.543	negative regulation of cellular process
GO:0048522	0.507	positive regulation of cellular process
GO:0010604	0.480	positive regulation of macromolecule metabolic process
GO:0050896	0.465	response to stimulus
GO:0051173	0.461	positive regulation of nitrogen compound metabolic process
GO:0010556	0.441	regulation of macromolecule biosynthetic process
GO:0031326	0.439	regulation of cellular biosynthetic process
GO:0033554	0.425	cellular response to stress
GO:0031325	0.415	positive regulation of cellular metabolic process
GO:0010605	0.412	negative regulation of macromolecule metabolic process
GO:0010468	0.396	regulation of gene expression
GO:0051172	0.388	negative regulation of nitrogen compound metabolic process
GO:0045935	0.375	positive regulation of nucleobase-containing compound metabolic process
GO:0031324	0.365	negative regulation of cellular metabolic process
GO:0045934	0.358	negative regulation of nucleobase-containing compound metabolic process
GO:2001141	0.315	regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0043232	1.000	intracellular non-membrane-bounded organelle
GO:0031981	1.000	nuclear lumen
GO:0005654	0.978	nucleoplasm
GO:0005737	0.972	cytoplasm
GO:0005694	0.954	chromosome
GO:0005657	0.519	replication fork
GO:1902494	0.464	catalytic complex
GO:0005730	0.435	nucleolus
GO:0005663	0.391	DNA replication factor C complex
GO:0031391	0.383	Elg1 RFC-like complex
GO:0005576	0.322	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]