StarFunc result for job id P35269

User Input

>input (517 residues)
MAALGPSSQNVTEYVVRVPKNTTKKYNIMAFNAADKVNFATWNQARLERDLSNKKIYQEE
EMPESGAGSEFNRKLREEARRKKYGIVLKEFRPEDQPWLLRVNGKSGRKFKGIKKGGVTE
NTSYYIFTQCPDGAFEAFPVHNWYNFTPLARHRTLTAEEAEEEWERRNKVLNHFSIMQQR
RLKDQDQDEDEEEKEKRGRRKASELRIHDLEDDLEMSSDASDASGEEGGRVPKAKKKAPL
AKGGRKKKKKKGSDDEAFEDSDDGDFEGQEVDYMSDGSSSSQEEPESKAKAPQQEEGPKG
VDEQSDSSEESEEEKPPEEDKEEEEEKKAPTPQEKKRRKDSSEESDSSEESDIDSEASSA
LFMAKKKTPPKRERKPSGGSSRGNSRPGTPSAEGGSTSSTLRAAASKLEQGKRVSEMPAA
KRLRLDTGPQSLSGKSTPQPPSGKTTPNSGDVQVTEDAVRRYLTRKPMTTKDLLKKFQTK
KTGLSSEQTVNVLAQILKRLNPERKMINDKMHFSLKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35269	1.000	1.000	2.449E-78	517	1.000	1.000	P35269.pdb.gz	T2FA_HUMAN General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2
2	AFDB:Q05913	0.284	0.258	3.387E-35	577	0.371	0.333	Q05913.pdb.gz	T2FA_DROME General transcription factor IIF subunit 1 OS=Drosophila melanogaster OX=7227 GN=TfIIFalpha PE=1 SV=3
3	PDB:6o9lS	0.246	0.644	1.808E-25	176	0.338	0.994	6o9lS.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
4	PDB:5iy6S	0.221	0.758	3.027E-21	138	0.265	0.993	5iy6S.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
5	PDB:7o72Q	0.196	0.422	6.031E-9	222	0.068	0.158	7o72Q.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
6	PDB:6gylQ	0.186	0.578	2.675E-7	148	0.070	0.243	6gylQ.pdb.gz	Promoter Distortion and Opening in the RNA Polymerase II Cleft.
7	PDB:6h68M	0.154	0.191	8.257E-3	396	0.023	0.030	6h68M.pdb.gz	Structural basis of RNA polymerase I stalling at UV light-induced DNA damage.
8	PDB:7ob9M	0.159	0.205	1.267E-2	388	0.033	0.044	7ob9M.pdb.gz	Cryo-EM structures of human RNA polymerase I.
9	PDB:7okxO	0.147	0.611	1.720E-2	106	0.027	0.132	7okxO.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
10	PDB:7okxM	0.126	0.406	2.197E-2	139	0.023	0.086	7okxM.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
11	PDB:6eu0M	0.132	0.296	2.640E-2	197	0.044	0.117	6eu0M.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
12	PDB:5m64M	0.138	0.203	3.371E-2	323	0.014	0.022	5m64M.pdb.gz	Molecular Structures of Transcribing RNA Polymerase I.
13	AFDB:Q8JG61	0.065	0.034	2.836E-1	1534	0.110	0.037	Q8JG61.pdb.gz	Q8JG61_DANRE Erythrocyte membrane protein band 4.1 (Elliptocytosis 1, RH-linked) OS=Danio rerio OX=7955 GN=epb41 PE=2 SV=1
14	AFDB:G5EDJ6	0.065	0.046	4.352E-1	784	0.126	0.083	G5EDJ6.pdb.gz	G5EDJ6_CAEEL Auxilin OS=Caenorhabditis elegans OX=6239 GN=dnj-25 PE=1 SV=1
15	AFDB:A0A0B4KF25	0.080	0.040	5.909E-1	1131	0.116	0.053	A0A0B4KF25.pdb.gz	A0A0B4KF25_DROME Reduction in Cnn dots 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Rcd1 PE=1 SV=1
16	AFDB:P37304	0.085	0.058	9.067E-1	830	0.116	0.072	P37304.pdb.gz	PAM1_YEAST Protein PAM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PAM1 PE=1 SV=2
17	AFDB:Q1ZS71	0.076	0.040	1.158	1094	0.133	0.063	Q1ZS71.pdb.gz	Q1ZS71_PHOAS Ribonuclease E OS=Photobacterium angustum (strain S14 / CCUG 15956) OX=314292 GN=rne PE=1 SV=1
18	AFDB:A7MD62	0.051	0.049	1.231	845	0.108	0.066	A7MD62.pdb.gz
19	AFDB:E1BUG7	0.061	0.049	1.479	690	0.164	0.123	E1BUG7.pdb.gz	SPT2_CHICK Protein SPT2 homolog OS=Gallus gallus OX=9031 GN=SPTY2D1 PE=1 SV=3
20	AFDB:Q08D68	0.053	0.037	1.572	853	0.103	0.062	Q08D68.pdb.gz	ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis OX=8364 GN=znrf3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	M0QXD6	0.0	826	433	0.832	0.993	M0QXD6_HUMAN Transcription initiation factor IIF subunit alpha (Fragment) OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=1
2	M0R0R9	0.0	620	381	0.582	0.790	M0R0R9_HUMAN Transcription initiation factor IIF subunit alpha (Fragment) OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=1
3	P35269	0.0	1049	517	1.000	1.000	T2FA_HUMAN General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2
4	Q3THK3	0.0	805	508	0.915	0.931	T2FA_MOUSE General transcription factor IIF subunit 1 OS=Mus musculus OX=10090 GN=Gtf2f1 PE=1 SV=2
5	Q6AY96	0.0	804	508	0.915	0.931	T2FA_RAT General transcription factor IIF subunit 1 OS=Rattus norvegicus OX=10116 GN=Gtf2f1 PE=1 SV=1
6	Q05913	5.07e-64	220	577	0.286	0.256	T2FA_DROME General transcription factor IIF subunit 1 OS=Drosophila melanogaster OX=7227 GN=TfIIFalpha PE=1 SV=3
7	Q9SU25	3.83e-05	48.9	649	0.060	0.048	T2FA_ARATH Transcription initiation factor IIF subunit alpha OS=Arabidopsis thaliana OX=3702 GN=RAP74 PE=1 SV=1
8	Q5AMR1	1.91e-04	46.6	608	0.074	0.062	Q5AMR1_CANAL Transcription initiation factor IIF subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TFG1 PE=3 SV=1
9	Q8I3A0	0.003	43.1	2568	0.085	0.017	Q8I3A0_PLAF7 Copper-transporting ATPase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0904900 PE=4 SV=2
10	P41895	0.34	36.2	735	0.029	0.020	T2FA_YEAST Transcription initiation factor IIF subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TFG1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05793 TFIIF_alpha	7.2e-206	696.5	Transcription initiation factor IIF, alpha subunit (TFIIF-alpha)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000377969

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283875	0.999	General transcription factor IIE subunit 1
2	9606.ENSP00000340823	0.999	General transcription factor IIF subunit 2
3	9606.ENSP00000348168	0.999	Transcription initiation factor IIE subunit beta
4	9606.ENSP00000359531	0.999	Transcription initiation factor IIB
5	9606.ENSP00000370625	0.999	DNA-directed RNA polymerase II subunit RPB2
6	9606.ENSP00000480158	0.999	DNA-directed RNA polymerase II subunit RPB1
7	9606.ENSP00000484525	0.999	RNA polymerase II subunit A C-terminal domain phosphatase
8	9606.ENSP00000221859	0.998	DNA-directed RNA polymerase II subunit RPB9
9	9606.ENSP00000375942	0.998	TATA-box-binding protein
10	9606.ENSP00000406549	0.998	Transcription initiation factor TFIID subunit 1
11	9606.ENSP00000478303	0.998	DNA-directed RNA polymerases I, II, and III subunit RPABC1
12	9606.ENSP00000219252	0.997	DNA-directed RNA polymerase II subunit RPB3
13	9606.ENSP00000379372	0.997	Transcription initiation factor IIA subunit 2
14	9606.ENSP00000285398	0.996	TFIIH basal transcription factor complex helicase XPB subunit
15	9606.ENSP00000428426	0.996	Transcription elongation factor A protein 1
16	9606.ENSP00000272645	0.995	DNA-directed RNA polymerase II subunit RPB4
17	9606.ENSP00000375809	0.995	TFIIH basal transcription factor complex helicase XPD subunit
18	9606.ENSP00000452454	0.995	Transcription initiation factor IIA subunit 1
19	9606.ENSP00000259895	0.994	General transcription factor IIH subunit 4
20	9606.ENSP00000340271	0.994	Transcription initiation factor TFIID subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008134	0.996	transcription factor binding
GO:0003676	0.995	nucleic acid binding
GO:0001091	0.988	RNA polymerase II general transcription initiation factor binding
GO:0003723	0.987	RNA binding
GO:0016251	0.976	RNA polymerase II general transcription initiation factor activity
GO:0019899	0.969	enzyme binding
GO:0003682	0.966	chromatin binding
GO:0008047	0.963	enzyme activator activity
GO:1990841	0.956	promoter-specific chromatin binding
GO:0019208	0.956	phosphatase regulator activity
GO:0019904	0.950	protein domain specific binding
GO:0019211	0.943	phosphatase activator activity
GO:0019902	0.941	phosphatase binding
GO:0019903	0.915	protein phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0006357	0.989	regulation of transcription by RNA polymerase II
GO:0045893	0.989	positive regulation of DNA-templated transcription
GO:0045944	0.968	positive regulation of transcription by RNA polymerase II
GO:0071704	0.896	organic substance metabolic process
GO:0044238	0.893	primary metabolic process
GO:0009987	0.891	cellular process
GO:0044237	0.875	cellular metabolic process
GO:0006807	0.874	nitrogen compound metabolic process
GO:0043170	0.845	macromolecule metabolic process
GO:0016070	0.803	RNA metabolic process
GO:0010467	0.789	gene expression
GO:0006351	0.762	DNA-templated transcription
GO:0006366	0.743	transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	1.000	nucleoplasm
GO:0030054	0.997	cell junction
GO:0061695	0.995	transferase complex, transferring phosphorus-containing groups
GO:0016591	0.994	RNA polymerase II, holoenzyme
GO:0090575	0.989	RNA polymerase II transcription regulator complex
GO:0005669	0.814	transcription factor TFIID complex
GO:0005737	0.760	cytoplasm
GO:0008023	0.412	transcription elongation factor complex
GO:0043232	0.402	intracellular non-membrane-bounded organelle
GO:0005674	0.384	transcription factor TFIIF complex
GO:0016593	0.361	Cdc73/Paf1 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]