StarFunc result for job id P35270

User Input

>input (261 residues)
MEGGLGRAVCLLTGASRGFGRTLAPLLASLLSPGSVLVLSARNDEALRQLEAELGAERSG
LRVVRVPADLGAEAGLQQLLGALRELPRPKGLQRLLLINNAGSLGDVSKGFVDLSDSTQV
NNYWALNLTSMLCLTSSVLKAFPDSPGLNRTVVNISSLCALQPFKGWALYCAGKAARDML
FQVLALEEPNVRVLNYAPGPLDTDMQQLARETSVDPDMRKGLQELKAKGKLVDCKVSAQK
LLSLLEKDEFKSGAHVDFYDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35270	1.000	1.000	1.107E-53	261	1.000	1.000	P35270.pdb.gz	SPRE_HUMAN Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1
2	PDB:6i79A	0.985	0.949	2.331E-51	271	1.000	0.963	6i79A.pdb.gz	Fragment-Based Discovery of Novel Potent Sepiapterin Reductase Inhibitors.
3	AFDB:P18297	0.990	0.986	1.150E-45	262	0.747	0.744	P18297.pdb.gz	SPRE_RAT Sepiapterin reductase OS=Rattus norvegicus OX=10116 GN=Spr PE=1 SV=1
4	AFDB:Q64105	0.992	0.992	1.860E-45	261	0.743	0.743	Q64105.pdb.gz	SPRE_MOUSE Sepiapterin reductase OS=Mus musculus OX=10090 GN=Spr PE=1 SV=1
5	PDB:1nasA	0.981	0.988	8.058E-43	259	0.736	0.741	1nasA.pdb.gz	The 1.25 A crystal structure of sepiapterin reductase reveals its binding mode to pterins and brain neurotransmitters.
6	AFDB:O76752	0.906	0.906	1.226E-25	261	0.337	0.337	O76752.pdb.gz	O76752_DROME Sepiapterin reductase OS=Drosophila melanogaster OX=7227 GN=Sptr PE=1 SV=1
7	AFDB:Q54GP3	0.886	0.867	7.960E-22	267	0.314	0.307	Q54GP3.pdb.gz	SPRE_DICDI Sepiapterin reductase OS=Dictyostelium discoideum OX=44689 GN=sprA PE=1 SV=1
8	AFDB:P40580	0.834	0.828	5.488E-18	263	0.280	0.278	P40580.pdb.gz	BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC24 PE=1 SV=1
9	AFDB:O14351	0.788	0.829	2.149E-16	247	0.261	0.275	O14351.pdb.gz	YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC30D10.05c PE=3 SV=1
10	AFDB:P40579	0.813	0.834	4.421E-16	254	0.284	0.291	P40579.pdb.gz	YIV5_YEAST Uncharacterized oxidoreductase YIR035C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIR035C PE=1 SV=1
11	AFDB:Q6KF77	0.795	0.795	8.566E-16	261	0.234	0.234	Q6KF77.pdb.gz	Q6KF77_SOLTU Tropinone reductase II OS=Solanum tuberosum OX=4113 GN=trII PE=2 SV=1
12	AFDB:D3J0Z1	0.778	0.778	1.157E-15	261	0.192	0.192	D3J0Z1.pdb.gz	CHADH_ASPFM Chanoclavine-I dehydrogenase OS=Aspergillus fumigatus OX=746128 GN=fgaDH PE=1 SV=1
13	PDB:6uhxB	0.815	0.836	1.985E-15	254	0.287	0.295	6uhxB.pdb.gz	Crystal structure of YIR035C short chain dehydrogenases/reductase from Saccharomyces cerevisiae
14	PDB:3d3wA	0.762	0.810	4.606E-15	244	0.264	0.283	3d3wA.pdb.gz	Structure/function analysis of a critical disulfide bond in the active site of L-xylulose reductase.
15	PDB:1cydA	0.748	0.802	5.516E-15	242	0.249	0.269	1cydA.pdb.gz	Crystal structure of the ternary complex of mouse lung carbonyl reductase at 1.8 A resolution: the structural origin of coenzyme specificity in the short-chain dehydrogenase/reductase family.
16	PDB:3rkuA	0.771	0.753	5.516E-15	268	0.203	0.198	3rkuA.pdb.gz	Substrate Fingerprint and the Structure of NADP+ Dependent Serine Dehydrogenase from Saccharomyces cerevisiae complexed with NADP+
17	PDB:3ay6B	0.760	0.745	2.199E-14	267	0.222	0.217	3ay6B.pdb.gz	Structure-guided mutagenesis for the improvement of substrate speciﬁcity of Bacillus megaterium glucose 1-dehydrogenase IV
18	PDB:2zatA	0.746	0.773	6.490E-14	251	0.211	0.219	2zatA.pdb.gz	Molecular basis for peroxisomal localization of tetrameric carbonyl reductase.
19	PDB:6t7mD	0.751	0.784	8.766E-14	249	0.234	0.245	6t7mD.pdb.gz
20	PDB:2gdzA	0.741	0.729	9.886E-14	266	0.241	0.237	2gdzA.pdb.gz	High-Affinity Inhibitors of Human NAD-Dependent 15-Hydroxyprostaglandin Dehydrogenase: Mechanisms of Inhibition and Structure-Activity Relationships.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35270	0.0	520	261	1.000	1.000	SPRE_HUMAN Sepiapterin reductase OS=Homo sapiens OX=9606 GN=SPR PE=1 SV=1
2	P18297	4.68e-141	398	262	0.747	0.744	SPRE_RAT Sepiapterin reductase OS=Rattus norvegicus OX=10116 GN=Spr PE=1 SV=1
3	Q64105	1.62e-139	394	261	0.736	0.736	SPRE_MOUSE Sepiapterin reductase OS=Mus musculus OX=10090 GN=Spr PE=1 SV=1
4	O76752	3.11e-40	141	261	0.349	0.349	O76752_DROME Sepiapterin reductase OS=Drosophila melanogaster OX=7227 GN=Sptr PE=1 SV=1
5	Q54GP3	2.58e-33	124	267	0.310	0.303	SPRE_DICDI Sepiapterin reductase OS=Dictyostelium discoideum OX=44689 GN=sprA PE=1 SV=1
6	P40579	4.27e-18	83.2	254	0.284	0.291	YIV5_YEAST Uncharacterized oxidoreductase YIR035C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YIR035C PE=1 SV=1
7	C8VUY4	1.23e-15	77.0	313	0.222	0.185	C8VUY4_EMENI Oxidoreductase, short chain dehydrogenase/reductase family (AFU_orthologue AFUA_5G11240) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_00179 PE=3 SV=1
8	P40580	1.45e-15	76.3	263	0.280	0.278	BZRD_YEAST Benzil reductase ((S)-benzoin forming) IRC24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IRC24 PE=1 SV=1
9	O14351	2.42e-13	69.7	247	0.264	0.279	YB45_SCHPO Uncharacterized oxidoreductase C30D10.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC30D10.05c PE=3 SV=1
10	Q21929	5.84e-13	68.9	251	0.253	0.263	DCXR_CAEEL L-xylulose reductase OS=Caenorhabditis elegans OX=6239 GN=dhs-21 PE=1 SV=2
11	Q9F5L5	1.04e-10	62.8	261	0.230	0.230	Q9F5L5_BACIU Glucose dehydrogenase (Fragment) OS=Bacillus subtilis OX=1423 PE=4 SV=1
12	P9WGR5	6.39e-09	57.4	251	0.241	0.251	Y484_MYCTU Uncharacterized oxidoreductase Rv0484c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0484c PE=1 SV=1
13	P39485	7.97e-09	57.0	261	0.218	0.218	DHG4_PRIMG Glucose 1-dehydrogenase 4 OS=Priestia megaterium OX=1404 GN=gdhIV PE=1 SV=1
14	Q8L7U0	1.22e-08	57.0	328	0.238	0.189	Q8L7U0_ARATH AT3g03330/T21P5_25 OS=Arabidopsis thaliana OX=3702 GN=At3g03330 PE=1 SV=1
15	Q05016	1.39e-08	56.6	267	0.203	0.199	YM71_YEAST NADP-dependent 3-hydroxy acid dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YMR226C PE=1 SV=1
16	P0AEK2	3.61e-08	55.1	244	0.253	0.270	FABG_ECOLI 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Escherichia coli (strain K12) OX=83333 GN=fabG PE=1 SV=1
17	Q9P7B4	5.62e-08	54.7	259	0.207	0.208	YI13_SCHPO NADP-dependent 3-hydroxy acid dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC521.03 PE=1 SV=1
18	Q9FYL6	5.94e-08	55.1	312	0.241	0.202	KCR2_ARATH Very-long-chain 3-oxoacyl-CoA reductase-like protein At1g24470 OS=Arabidopsis thaliana OX=3702 GN=KCR2 PE=2 SV=1
19	P08074	8.23e-08	53.9	244	0.245	0.262	CBR2_MOUSE Carbonyl reductase [NADPH] 2 OS=Mus musculus OX=10090 GN=Cbr2 PE=1 SV=1
20	P0A2C9	1.15e-07	53.5	244	0.230	0.246	FABG_SALTY 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=fabG PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	1e-25	101.9	short chain dehydrogenase
2	PF13561 adh_short_C2	1.2e-11	56.2	Enoyl-(Acyl carrier protein) reductase
3	PF08659 KR	0.45	21.9	KR domain
4	PF18604 PreAtp-grasp	76	15.2	Pre ATP-grasp domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000234454

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000281243	0.982	Dihydropteridine reductase
2	9606.ENSP00000448059	0.979	Catalyzes the hydroxylation of L-phenylalanine to L-tyrosine.
3	9606.ENSP00000280362	0.975	6-pyruvoyl tetrahydrobiopterin synthase
4	9606.ENSP00000290349	0.973	Carbonyl reductase [NADPH] 1
5	9606.ENSP00000396308	0.972	Dihydrofolate reductase
6	9606.ENSP00000370571	0.968	Tyrosine 3-monooxygenase
7	9606.ENSP00000250018	0.965	Belongs to the biopterin-dependent aromatic amino acid hydroxylase family
8	9606.ENSP00000285930	0.957	Aldose reductase
9	9606.ENSP00000329093	0.938	Tryptophan hydroxylase 2
10	9606.ENSP00000377768	0.930	Dihydrofolate reductase 2, mitochondrial
11	9606.ENSP00000419045	0.928	GTP cyclohydrolase 1
12	9606.ENSP00000244217	0.916	Methylmalonyl-CoA epimerase, mitochondrial
13	9606.ENSP00000369927	0.915	Aldo-keto reductase family 1 member C3
14	9606.ENSP00000352584	0.910	Aldo-keto reductase family 1 member B10
15	9606.ENSP00000264399	0.903	cGMP-dependent protein kinase 2
16	9606.ENSP00000297494	0.805	Nitric oxide synthase, endothelial
17	9606.ENSP00000260447	0.803	GTP cyclohydrolase 1 feedback regulatory protein
18	9606.ENSP00000341662	0.803	Alkylglycerol monooxygenase
19	9606.ENSP00000274813	0.778	Methylmalonyl-CoA mutase, mitochondrial
20	9606.ENSP00000299299	0.778	Pterin-4-alpha-carbinolamine dehydratase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016616	1.000	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0030554	0.998	adenyl nucleotide binding
GO:0005515	0.996	protein binding
GO:0050661	0.851	NADP binding
GO:0042802	0.802	identical protein binding
GO:0004033	0.749	aldo-keto reductase (NADP) activity
GO:0046983	0.345	protein dimerization activity
GO:0042803	0.305	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042558	0.999	pteridine-containing compound metabolic process
GO:0034641	0.998	cellular nitrogen compound metabolic process
GO:0034311	0.998	diol metabolic process
GO:1901576	0.995	organic substance biosynthetic process
GO:1901362	0.989	organic cyclic compound biosynthetic process
GO:1901617	0.984	organic hydroxy compound biosynthetic process
GO:0044283	0.982	small molecule biosynthetic process
GO:0044271	0.977	cellular nitrogen compound biosynthetic process
GO:0019438	0.969	aromatic compound biosynthetic process
GO:0046173	0.966	polyol biosynthetic process
GO:1901566	0.956	organonitrogen compound biosynthetic process
GO:0018130	0.932	heterocycle biosynthetic process
GO:0042559	0.895	pteridine-containing compound biosynthetic process
GO:0034312	0.892	diol biosynthetic process
GO:2001057	0.842	reactive nitrogen species metabolic process
GO:0044238	0.480	primary metabolic process
GO:0050896	0.384	response to stimulus
GO:0046209	0.343	nitric oxide metabolic process
GO:0006809	0.333	nitric oxide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0070013	0.997	intracellular organelle lumen
GO:0005634	0.995	nucleus
GO:0005654	0.994	nucleoplasm
GO:0005576	0.991	extracellular region
GO:0031982	0.962	vesicle
GO:0005615	0.954	extracellular space
GO:0043230	0.939	extracellular organelle
GO:1903561	0.930	extracellular vesicle
GO:0070062	0.924	extracellular exosome
GO:0005739	0.322	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.1.1.-	1.000	With NAD(+) or NADP(+) as acceptor.

[back to server]