StarFunc result for job id P35318

User Input

>input (185 residues)
MKLVSVALMYLGSLAFLGADTARLDVASEFRKKWNKWALSRGKRELRMSSSYPTGLADVK
AGPAQTLIRPQDMKGASRSPEDSSPDAARIRVKRYRQSMNNFQGLRSFGCRFGTCTVQKL
AHQIYQFTDKDKDNVAPRSKISPQGYGRRRRRSLPEAGPGRTLVSSKPQAHGAPAPPSGS
APHFL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35318	1.000	1.000	1.986E-28	185	1.000	1.000	P35318.pdb.gz	ADML_HUMAN Pro-adrenomedullin OS=Homo sapiens OX=9606 GN=ADM PE=1 SV=1
2	AFDB:P43145	0.388	0.388	5.795E-17	185	0.697	0.697	P43145.pdb.gz	ADML_RAT Pro-adrenomedullin OS=Rattus norvegicus OX=10116 GN=Adm PE=1 SV=1
3	AFDB:P97297	0.303	0.305	1.084E-12	184	0.643	0.647	P97297.pdb.gz	ADML_MOUSE Pro-adrenomedullin OS=Mus musculus OX=10090 GN=Adm PE=2 SV=2
4	AFDB:Q8VIB2	0.236	0.072	1.235E-1	731	0.211	0.053	Q8VIB2.pdb.gz	DAXX_RAT Death domain-associated protein 6 OS=Rattus norvegicus OX=10116 GN=Daxx PE=1 SV=1
5	AFDB:A0A1D8PFP3	0.189	0.032	8.099E-1	1504	0.103	0.013	A0A1D8PFP3.pdb.gz	A0A1D8PFP3_CANAL 5'-3' exoribonuclease 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=KEM1 PE=3 SV=1
6	AFDB:Q9VU84	0.212	0.083	1.553	531	0.184	0.064	Q9VU84.pdb.gz	DBNL_DROME Drebrin-like protein OS=Drosophila melanogaster OX=7227 GN=Abp1 PE=1 SV=1
7	AFDB:Q9VIE6	0.120	0.051	1.794	776	0.157	0.037	Q9VIE6.pdb.gz	MCM10_DROME Protein MCM10 homolog OS=Drosophila melanogaster OX=7227 GN=Mcm10 PE=1 SV=2
8	AFDB:Q86Z20	0.181	0.071	2.229	511	0.124	0.045	Q86Z20.pdb.gz	CC125_HUMAN Coiled-coil domain-containing protein 125 OS=Homo sapiens OX=9606 GN=CCDC125 PE=1 SV=2
9	AFDB:Q86X45	0.151	0.068	2.397	466	0.114	0.045	Q86X45.pdb.gz	DAA11_HUMAN Dynein axonemal assembly factor 11 OS=Homo sapiens OX=9606 GN=DNAAF11 PE=1 SV=3
10	AFDB:F4I642	0.187	0.060	2.770	928	0.173	0.034	F4I642.pdb.gz	F4I642_ARATH Ubiquitin-specific protease 15 OS=Arabidopsis thaliana OX=3702 GN=UBP15 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35318	5.13e-136	379	185	1.000	1.000	ADML_HUMAN Pro-adrenomedullin OS=Homo sapiens OX=9606 GN=ADM PE=1 SV=1
2	P43145	1.60e-87	256	185	0.697	0.697	ADML_RAT Pro-adrenomedullin OS=Rattus norvegicus OX=10116 GN=Adm PE=1 SV=1
3	P97297	2.98e-77	230	184	0.654	0.658	ADML_MOUSE Pro-adrenomedullin OS=Mus musculus OX=10090 GN=Adm PE=2 SV=2
4	Q7Z4H4	0.007	37.7	148	0.092	0.115	ADM2_HUMAN Protein ADM2 OS=Homo sapiens OX=9606 GN=ADM2 PE=1 SV=1
5	P61312	0.010	37.4	146	0.103	0.130	ADM2_RAT Protein ADM2 OS=Rattus norvegicus OX=10116 GN=Adm2 PE=1 SV=1
6	A9JRP6	1.0	32.0	254	0.103	0.075	A9JRP6_DANRE Iodothyronine deiodinase OS=Danio rerio OX=7955 GN=dio1 PE=2 SV=2
7	Q802F6	1.3	31.6	241	0.103	0.079	Q802F6_DANRE Iodothyronine deiodinase (Fragment) OS=Danio rerio OX=7955 GN=dio1 PE=2 SV=2
8	P01256	1.6	30.8	128	0.076	0.109	CALCA_RAT Calcitonin gene-related peptide 1 OS=Rattus norvegicus OX=10116 GN=Calca PE=2 SV=1
9	P12259	1.7	31.6	2224	0.211	0.018	FA5_HUMAN Coagulation factor V OS=Homo sapiens OX=9606 GN=F5 PE=1 SV=4
10	Q99JA0	1.7	30.4	128	0.076	0.109	CALCA_MOUSE Calcitonin gene-related peptide 1 OS=Mus musculus OX=10090 GN=Calca PE=2 SV=1
11	Q9Y7S5	4.9	30.0	478	0.097	0.038	YQO6_SCHPO Uncharacterized membrane protein C569.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC569.06 PE=3 SV=1
12	Q9Z2C9	5.5	30.0	660	0.086	0.024	MTMR7_MOUSE Myotubularin-related protein 7 OS=Mus musculus OX=10090 GN=Mtmr7 PE=1 SV=2
13	E7FB43	10.0	29.3	520	0.124	0.044	E7FB43_DANRE Glucagon receptor a OS=Danio rerio OX=7955 GN=gcgra PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00214 Calc_CGRP_IAPP	7.9e-24	96.1	Calcitonin / CGRP / IAPP family
2	PF00147 Fibrinogen_C	1.2e+02	13.9	Fibrinogen beta and gamma chains, C-terminal globular domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436607

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253796	0.999	Receptor activity-modifying protein 2
2	9606.ENSP00000386972	0.999	Calcitonin gene-related peptide type 1 receptor
3	9606.ENSP00000242249	0.998	Receptor activity-modifying protein 3
4	9606.ENSP00000254661	0.990	Receptor activity-modifying protein 1
5	9606.ENSP00000356399	0.980	Complement factor H
6	9606.ENSP00000331746	0.974	Calcitonin
7	9606.ENSP00000352561	0.965	Calcitonin receptor
8	9606.ENSP00000240652	0.957	Islet amyloid polypeptide
9	9606.ENSP00000433490	0.950	Calcitonin gene-related peptide 2
10	9606.ENSP00000379087	0.923	ADM2
11	9606.ENSP00000369647	0.835	Vasopressin-neurophysin 2-copeptin
12	9606.ENSP00000300098	0.825	G-protein coupled receptor 182
13	9606.ENSP00000360141	0.812	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
14	9606.ENSP00000334448	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
15	9606.ENSP00000481878	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
16	9606.ENSP00000356213	0.778	VIP peptides
17	9606.ENSP00000368683	0.773	Endothelin-1
18	9606.ENSP00000384092	0.741	Pro-opiomelanocortin
19	9606.ENSP00000378736	0.728	DNA-directed RNA polymerase III subunit RPC9
20	9606.ENSP00000272190	0.698	Renin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031700	1.000	adrenomedullin receptor binding
GO:0098772	0.840	molecular function regulator activity
GO:0030546	0.825	signaling receptor activator activity
GO:0048018	0.594	receptor ligand activity
GO:0042802	0.436	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.995	regulation of cellular process
GO:0032501	0.992	multicellular organismal process
GO:0009987	0.992	cellular process
GO:0050896	0.988	response to stimulus
GO:0065008	0.985	regulation of biological quality
GO:0007275	0.980	multicellular organism development
GO:0048519	0.978	negative regulation of biological process
GO:0048518	0.978	positive regulation of biological process
GO:0048522	0.969	positive regulation of cellular process
GO:0007154	0.967	cell communication
GO:0051239	0.965	regulation of multicellular organismal process
GO:0006950	0.964	response to stress
GO:0051240	0.960	positive regulation of multicellular organismal process
GO:0007186	0.941	G protein-coupled receptor signaling pathway
GO:0019222	0.938	regulation of metabolic process
GO:0048583	0.933	regulation of response to stimulus
GO:0007189	0.930	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0008015	0.921	blood circulation
GO:0006952	0.914	defense response
GO:0023051	0.912	regulation of signaling
GO:0010646	0.910	regulation of cell communication
GO:0009893	0.906	positive regulation of metabolic process
GO:0080090	0.904	regulation of primary metabolic process
GO:0048523	0.903	negative regulation of cellular process
GO:0031323	0.903	regulation of cellular metabolic process
GO:0003018	0.880	vascular process in circulatory system
GO:0008016	0.866	regulation of heart contraction
GO:0009605	0.865	response to external stimulus
GO:0009966	0.859	regulation of signal transduction
GO:0048731	0.858	system development
GO:0002376	0.849	immune system process
GO:0097746	0.832	blood vessel diameter maintenance
GO:0031326	0.826	regulation of cellular biosynthetic process
GO:0031325	0.821	positive regulation of cellular metabolic process
GO:0010817	0.805	regulation of hormone levels
GO:0009891	0.756	positive regulation of biosynthetic process
GO:0019216	0.737	regulation of lipid metabolic process
GO:0045823	0.709	positive regulation of heart contraction
GO:0009653	0.696	anatomical structure morphogenesis
GO:0062012	0.686	regulation of small molecule metabolic process
GO:0051179	0.662	localization
GO:0048585	0.627	negative regulation of response to stimulus
GO:0044419	0.612	biological process involved in interspecies interaction between organisms
GO:0051234	0.605	establishment of localization
GO:0019218	0.595	regulation of steroid metabolic process
GO:0009607	0.580	response to biotic stimulus
GO:0008217	0.562	regulation of blood pressure
GO:0006810	0.554	transport
GO:0051707	0.552	response to other organism
GO:0008152	0.548	metabolic process
GO:0071704	0.524	organic substance metabolic process
GO:0003073	0.516	regulation of systemic arterial blood pressure
GO:0060255	0.495	regulation of macromolecule metabolic process
GO:0044238	0.477	primary metabolic process
GO:0006955	0.462	immune response
GO:0030154	0.443	cell differentiation
GO:0072359	0.436	circulatory system development
GO:0006959	0.421	humoral immune response
GO:0001944	0.413	vasculature development
GO:0051241	0.402	negative regulation of multicellular organismal process
GO:0035239	0.395	tube morphogenesis
GO:0032879	0.387	regulation of localization
GO:0009617	0.387	response to bacterium
GO:0042127	0.385	regulation of cell population proliferation
GO:0050793	0.379	regulation of developmental process
GO:0019730	0.379	antimicrobial humoral response
GO:0042221	0.356	response to chemical
GO:0044237	0.320	cellular metabolic process
GO:0031328	0.303	positive regulation of cellular biosynthetic process
GO:0051049	0.301	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	1.000	extracellular space
GO:0005737	0.999	cytoplasm
GO:0043226	0.603	organelle
GO:0043229	0.571	intracellular organelle
GO:0043233	0.436	organelle lumen
GO:0043227	0.407	membrane-bounded organelle
GO:0070013	0.372	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]