StarFunc result for job id P35348

User Input

>input (466 residues)
MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0ZBD3	0.711	0.698	1.708E-57	475	0.923	0.905	B0ZBD3.pdb.gz	B0ZBD3_HUMAN Alpha-1A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1A PE=3 SV=1
2	AFDB:P43140	0.798	0.798	2.152E-57	466	0.927	0.927	P43140.pdb.gz	ADA1A_RAT Alpha-1A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra1a PE=2 SV=1
3	AFDB:P35368	0.696	0.626	2.675E-39	520	0.500	0.448	P35368.pdb.gz	ADA1B_HUMAN Alpha-1B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1B PE=1 SV=3
4	AFDB:P97714	0.666	0.556	3.938E-35	562	0.451	0.374	P97714.pdb.gz	ADA1D_MOUSE Alpha-1D adrenergic receptor OS=Mus musculus OX=10090 GN=Adra1d PE=1 SV=1
5	AFDB:P23944	0.670	0.560	9.908E-35	561	0.451	0.374	P23944.pdb.gz	ADA1D_RAT Alpha-1D adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra1d PE=2 SV=2
6	AFDB:P25100	0.660	0.542	1.572E-34	572	0.466	0.379	P25100.pdb.gz	ADA1D_HUMAN Alpha-1D adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1D PE=1 SV=2
7	AFDB:P08588	0.602	0.589	5.205E-24	477	0.298	0.291	P08588.pdb.gz	ADRB1_HUMAN Beta-1 adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRB1 PE=1 SV=3
8	AFDB:Q24563	0.637	0.554	9.483E-24	539	0.320	0.276	Q24563.pdb.gz	DOPR2_DROME Dopamine receptor 2 OS=Drosophila melanogaster OX=7227 GN=Dop1R2 PE=2 SV=1
9	AFDB:Q8UUY8	0.598	0.677	6.288E-23	409	0.281	0.320	Q8UUY8.pdb.gz	ADRB2_ONCMY Beta-2 adrenergic receptor OS=Oncorhynchus mykiss OX=8022 GN=adrb2 PE=2 SV=1
10	AFDB:Q98998	0.612	0.697	1.045E-22	408	0.255	0.292	Q98998.pdb.gz	5HT1A_XENLA 5-hydroxytryptamine receptor 1A OS=Xenopus laevis OX=8355 GN=htr1a PE=2 SV=1
11	PDB:7jvqR	0.539	0.863	4.290E-19	286	0.242	0.395	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
12	PDB:6iblA	0.555	0.648	6.805E-19	397	0.249	0.292	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
13	PDB:7e32R	0.541	0.868	8.571E-19	285	0.230	0.375	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
14	PDB:7xtcR	0.538	0.895	1.712E-18	275	0.240	0.407	7xtcR.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
15	PDB:3pblA	0.523	0.563	3.120E-18	432	0.253	0.273	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
16	PDB:7cmuR	0.541	0.908	3.752E-18	272	0.238	0.408	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
17	PDB:7e2xR	0.540	0.886	3.929E-18	278	0.230	0.385	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:7xt8R	0.530	0.822	1.886E-17	294	0.227	0.361	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
19	PDB:5d5aA	0.553	0.581	4.532E-17	442	0.240	0.253	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.
20	PDB:7e33R	0.521	0.927	4.746E-17	257	0.212	0.385	7e33R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0ZBD3	0.0	877	475	0.914	0.897	B0ZBD3_HUMAN Alpha-1A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1A PE=3 SV=1
2	E7EW16	0.0	868	427	0.908	0.991	E7EW16_HUMAN Alpha-1A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1A PE=1 SV=1
3	P35348	0.0	956	466	1.000	1.000	ADA1A_HUMAN Alpha-1A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1A PE=1 SV=2
4	P43140	0.0	894	466	0.927	0.927	ADA1A_RAT Alpha-1A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra1a PE=2 SV=1
5	P97718	0.0	881	466	0.918	0.918	ADA1A_MOUSE Alpha-1A adrenergic receptor OS=Mus musculus OX=10090 GN=Adra1a PE=1 SV=3
6	P18841	2.78e-156	455	515	0.464	0.419	ADA1B_MESAU Alpha-1B adrenergic receptor OS=Mesocricetus auratus OX=10036 GN=ADRA1B PE=1 SV=1
7	P15823	3.34e-156	454	515	0.464	0.419	ADA1B_RAT Alpha-1B adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra1b PE=2 SV=2
8	P35368	8.72e-156	454	520	0.466	0.417	ADA1B_HUMAN Alpha-1B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1B PE=1 SV=3
9	P97717	1.78e-152	445	514	0.461	0.418	ADA1B_MOUSE Alpha-1B adrenergic receptor OS=Mus musculus OX=10090 GN=Adra1b PE=1 SV=2
10	P25100	1.96e-145	429	572	0.425	0.346	ADA1D_HUMAN Alpha-1D adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA1D PE=1 SV=2
11	P23944	3.00e-137	408	561	0.412	0.342	ADA1D_RAT Alpha-1D adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra1d PE=2 SV=2
12	P97714	8.33e-136	404	562	0.418	0.347	ADA1D_MOUSE Alpha-1D adrenergic receptor OS=Mus musculus OX=10090 GN=Adra1d PE=1 SV=1
13	P28222	8.00e-67	221	390	0.275	0.328	5HT1B_HUMAN 5-hydroxytryptamine receptor 1B OS=Homo sapiens OX=9606 GN=HTR1B PE=1 SV=1
14	X5D7I5	8.00e-67	221	390	0.275	0.328	X5D7I5_HUMAN 5-hydroxytryptamine receptor 1B (Fragment) OS=Homo sapiens OX=9606 GN=HTR1B PE=2 SV=1
15	P08908	3.66e-66	220	422	0.288	0.318	5HT1A_HUMAN 5-hydroxytryptamine receptor 1A OS=Homo sapiens OX=9606 GN=HTR1A PE=1 SV=3
16	P28334	6.01e-66	218	386	0.270	0.326	5HT1B_MOUSE 5-hydroxytryptamine receptor 1B OS=Mus musculus OX=10090 GN=Htr1b PE=2 SV=1
17	P28564	1.38e-65	218	386	0.270	0.326	5HT1B_RAT 5-hydroxytryptamine receptor 1B OS=Rattus norvegicus OX=10116 GN=Htr1b PE=2 SV=1
18	P18762	3.25e-65	218	418	0.277	0.309	ADRB2_MOUSE Beta-2 adrenergic receptor OS=Mus musculus OX=10090 GN=Adrb2 PE=1 SV=2
19	A0A060W6G8	9.83e-65	215	390	0.273	0.326	A0A060W6G8_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00082532001 PE=3 SV=1
20	P10608	2.03e-64	215	418	0.270	0.301	ADRB2_RAT Beta-2 adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adrb2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.4e-76	268.8	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	4	18.7	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	4.7e-14	64.0	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10328 7TM_GPCR_Srx	0.056	24.6	Serpentine type 7TM GPCR chemoreceptor Srx

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008975445.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008962979.1	0.954	Guanine nucleotide-binding protein subunit alpha-13
2	9597.XP_008971411.1	0.935	G protein subunit alpha 12
3	9597.XP_008970663.1	0.925	alpha-1B adrenergic receptor
4	9597.XP_008962111.1	0.912	G protein subunit alpha q
5	9597.XP_008970853.1	0.894	G protein subunit alpha 11
6	9597.XP_008973081.1	0.872	alpha-1D adrenergic receptor
7	9597.XP_003820026.1	0.787	Rho guanine nucleotide exchange factor 12 isoform X1
8	9597.XP_003822867.1	0.783	C-X-C chemokine receptor type 4
9	9597.XP_008965710.1	0.689	Arrestin beta 1
10	9597.XP_003811503.1	0.688	Guanine nucleotide-binding protein subunit alpha-14
11	9597.XP_003819301.1	0.688	Guanine nucleotide-binding protein subunit alpha-15
12	9597.XP_003825586.1	0.669	TATA-box binding protein associated factor 5
13	9597.XP_008960819.1	0.639	Arrestin beta 2
14	9597.XP_008971923.1	0.626	G protein subunit beta 3
15	9597.XP_003820643.1	0.625	Regulator of G-protein signaling 2
16	9597.XP_008955320.1	0.613	G protein subunit gamma 2
17	9597.XP_003827894.1	0.610	Guanine nucleotide-binding protein subunit beta-5
18	9597.XP_003816663.1	0.600	Leucine-rich repeat transmembrane neuronal protein 4
19	9597.XP_003820212.1	0.596	arrestin-C
20	9597.XP_003820237.1	0.592	Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004936	1.000	alpha-adrenergic receptor activity
GO:0005488	0.987	binding
GO:0005515	0.979	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0032501	0.991	multicellular organismal process
GO:0023052	0.988	signaling
GO:0007154	0.988	cell communication
GO:0051716	0.986	cellular response to stimulus
GO:0007186	0.977	G protein-coupled receptor signaling pathway
GO:0010646	0.969	regulation of cell communication
GO:0023051	0.968	regulation of signaling
GO:0048583	0.956	regulation of response to stimulus
GO:0048519	0.925	negative regulation of biological process
GO:1902533	0.908	positive regulation of intracellular signal transduction
GO:0003008	0.886	system process
GO:0043408	0.877	regulation of MAPK cascade
GO:0065008	0.829	regulation of biological quality
GO:0043410	0.822	positive regulation of MAPK cascade
GO:0042221	0.747	response to chemical
GO:0003012	0.739	muscle system process
GO:0035556	0.671	intracellular signal transduction
GO:0010033	0.587	response to organic substance
GO:0032502	0.576	developmental process
GO:0070887	0.569	cellular response to chemical stimulus
GO:0007275	0.563	multicellular organism development
GO:0007188	0.490	adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007267	0.477	cell-cell signaling
GO:0048523	0.462	negative regulation of cellular process
GO:0065009	0.457	regulation of molecular function
GO:0019222	0.453	regulation of metabolic process
GO:0051239	0.451	regulation of multicellular organismal process
GO:1901700	0.418	response to oxygen-containing compound
GO:0051179	0.413	localization
GO:0071310	0.408	cellular response to organic substance
GO:0009719	0.406	response to endogenous stimulus
GO:1901698	0.394	response to nitrogen compound
GO:0060255	0.394	regulation of macromolecule metabolic process
GO:0044057	0.393	regulation of system process
GO:0010243	0.365	response to organonitrogen compound
GO:1901701	0.349	cellular response to oxygen-containing compound
GO:0048731	0.338	system development
GO:0044093	0.321	positive regulation of molecular function
GO:0006950	0.314	response to stress
GO:1901699	0.313	cellular response to nitrogen compound
GO:0009605	0.312	response to external stimulus
GO:0031323	0.307	regulation of cellular metabolic process
GO:0050790	0.306	regulation of catalytic activity
GO:0032879	0.302	regulation of localization
GO:0080090	0.301	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.985	plasma membrane
GO:0005622	0.967	intracellular anatomical structure
GO:0005737	0.921	cytoplasm
GO:0043227	0.885	membrane-bounded organelle
GO:0043229	0.880	intracellular organelle
GO:0045202	0.802	synapse
GO:0043231	0.802	intracellular membrane-bounded organelle
GO:0005634	0.766	nucleus
GO:0005829	0.748	cytosol
GO:0031981	0.657	nuclear lumen
GO:0005654	0.644	nucleoplasm
GO:0098793	0.440	presynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]