StarFunc result for job id P35354

User Input

>input (604 residues)
MLARALLLCAVLALSHTANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCSTPEFL
TRIKLFLKPTPNTVHYILTHFKGFWNVVNNIPFLRNAIMSYVLTSRSHLIDSPPTYNADY
GYKSWEAFSNLSYYTRALPPVPDDCPTPLGVKGKKQLPDSNEIVEKLLLRRKFIPDPQGS
NMMFAFFAQHFTHQFFKTDHKRGPAFTNGLGHGVDLNHIYGETLARQRKLRLFKDGKMKY
QIIDGEMYPPTVKDTQAEMIYPPQVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNKQFQYQ
NRIAAEFNTLYHWHPLLPDTFQIHDQKYNYQQFIYNNSILLEHGITQFVESFTRQIAGRV
AGGRNVPPAVQKVSQASIDQSRQMKYQSFNEYRKRFMLKPYESFEELTGEKEMSAELEAL
YGDIDAVELYPALLVEKPRPDAIFGETMVEVGAPFSLKGLMGNVICSPAYWKPSTFGGEV
GFQIINTASIQSLICNNVKGCPFTSFSVPDPELIKTVTINASSSRSGLDDINPTVLLKER
STEL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35354	1.000	1.000	0.000	604	1.000	1.000	P35354.pdb.gz	PGH2_HUMAN Prostaglandin G/H synthase 2 OS=Homo sapiens OX=9606 GN=PTGS2 PE=1 SV=2
2	AFDB:F1MNI5	0.943	0.943	8.233E-103	604	0.891	0.891	F1MNI5.pdb.gz	F1MNI5_BOVIN Prostaglandin-endoperoxide synthase 2 OS=Bos taurus OX=9913 GN=PTGS2 PE=3 SV=1
3	AFDB:P35355	0.945	0.945	1.181E-102	604	0.864	0.864	P35355.pdb.gz	PGH2_RAT Prostaglandin G/H synthase 2 OS=Rattus norvegicus OX=10116 GN=Ptgs2 PE=1 SV=1
4	PDB:5f1aA	0.912	0.997	7.741E-98	553	0.914	0.998	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
5	AFDB:Q5RI06	0.942	0.938	6.922E-93	606	0.728	0.726	Q5RI06.pdb.gz	Q5RI06_DANRE Prostaglandin G/H synthase 2 precursor OS=Danio rerio OX=7955 GN=si:dkey-97o5.6 PE=2 SV=1
6	PDB:4rs0A	0.914	0.990	3.251E-92	557	0.808	0.876	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
7	AFDB:Q6P4V3	0.926	0.930	7.894E-86	601	0.671	0.674	Q6P4V3.pdb.gz
8	AFDB:A0A2R8QJU6	0.916	0.908	1.719E-82	609	0.598	0.593	A0A2R8QJU6.pdb.gz
9	AFDB:P05979	0.918	0.924	3.727E-82	600	0.591	0.595	P05979.pdb.gz	PGH1_SHEEP Prostaglandin G/H synthase 1 OS=Ovis aries OX=9940 GN=PTGS1 PE=1 SV=3
10	AFDB:P22437	0.916	0.919	6.244E-82	602	0.598	0.600	P22437.pdb.gz	PGH1_MOUSE Prostaglandin G/H synthase 1 OS=Mus musculus OX=10090 GN=Ptgs1 PE=1 SV=1
11	PDB:6y3cA	0.913	0.990	1.209E-76	557	0.591	0.641	6y3cA.pdb.gz
12	AFDB:A0A087X296	0.780	0.854	7.187E-69	551	0.551	0.604	A0A087X296.pdb.gz	A0A087X296_HUMAN Prostaglandin-endoperoxide synthase 1 OS=Homo sapiens OX=9606 GN=PTGS1 PE=1 SV=1
13	AFDB:Q9C9U3	0.591	0.567	1.704E-22	631	0.177	0.170	Q9C9U3.pdb.gz	DOX2_ARATH Alpha-dioxygenase 2 OS=Arabidopsis thaliana OX=3702 GN=DOX2 PE=2 SV=1
14	PDB:4hhrA	0.582	0.551	1.232E-20	640	0.185	0.175	4hhrA.pdb.gz	The crystal structure of alpha-Dioxygenase provides insight into diversity in the cyclooxygenase-peroxidase superfamily.
15	PDB:5mfaA	0.572	0.586	9.928E-16	588	0.154	0.158	5mfaA.pdb.gz	Structure of human promyeloperoxidase (proMPO) and the role of the propeptide in processing and maturation.
16	PDB:7wmvA	0.119	0.119	2.443	602	0.091	0.091	7wmvA.pdb.gz	Structural mechanism of SGLT1 inhibitors.
17	PDB:4ybqB	0.078	0.096	2.572	462	0.079	0.104	4ybqB.pdb.gz
18	PDB:6vrhA	0.073	0.078	3.691	541	0.071	0.079	6vrhA.pdb.gz	Chemical and structural investigation of the paroxetine-human serotonin transporter complex.
19	PDB:3rceA	0.065	0.059	5.296	683	0.033	0.029	3rceA.pdb.gz	X-ray structure of a bacterial oligosaccharyltransferase.
20	PDB:3b9yA	0.120	0.159	5.872	388	0.060	0.093	3b9yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087X296	0.0	688	551	0.536	0.588	A0A087X296_HUMAN Prostaglandin-endoperoxide synthase 1 OS=Homo sapiens OX=9606 GN=PTGS1 PE=1 SV=1
2	F1MNI5	0.0	1123	604	0.871	0.871	F1MNI5_BOVIN Prostaglandin-endoperoxide synthase 2 OS=Bos taurus OX=9913 GN=PTGS2 PE=3 SV=1
3	O62698	0.0	1122	604	0.869	0.869	PGH2_BOVIN Prostaglandin G/H synthase 2 OS=Bos taurus OX=9913 GN=PTGS2 PE=2 SV=2
4	P05979	0.0	782	600	0.583	0.587	PGH1_SHEEP Prostaglandin G/H synthase 1 OS=Ovis aries OX=9940 GN=PTGS1 PE=1 SV=3
5	P22437	0.0	781	602	0.594	0.596	PGH1_MOUSE Prostaglandin G/H synthase 1 OS=Mus musculus OX=10090 GN=Ptgs1 PE=1 SV=1
6	P23219	0.0	782	599	0.591	0.596	PGH1_HUMAN Prostaglandin G/H synthase 1 OS=Homo sapiens OX=9606 GN=PTGS1 PE=1 SV=2
7	P35354	0.0	1268	604	1.000	1.000	PGH2_HUMAN Prostaglandin G/H synthase 2 OS=Homo sapiens OX=9606 GN=PTGS2 PE=1 SV=2
8	P35355	0.0	1093	604	0.864	0.864	PGH2_RAT Prostaglandin G/H synthase 2 OS=Rattus norvegicus OX=10116 GN=Ptgs2 PE=1 SV=1
9	Q05769	0.0	1123	604	0.868	0.868	PGH2_MOUSE Prostaglandin G/H synthase 2 OS=Mus musculus OX=10090 GN=Ptgs2 PE=1 SV=1
10	Q5RI06	0.0	967	606	0.730	0.728	Q5RI06_DANRE Prostaglandin G/H synthase 2 precursor OS=Danio rerio OX=7955 GN=si:dkey-97o5.6 PE=2 SV=1
11	Q63921	0.0	778	602	0.591	0.593	PGH1_RAT Prostaglandin G/H synthase 1 OS=Rattus norvegicus OX=10116 GN=Ptgs1 PE=2 SV=2
12	Q8JH43	0.0	900	601	0.679	0.682	Q8JH43_DANRE Prostaglandin G/H synthase 2 OS=Danio rerio OX=7955 GN=ptgs2 PE=2 SV=1
13	Q8JH44	0.0	794	597	0.594	0.601	Q8JH44_DANRE Prostaglandin G/H synthase 1 OS=Danio rerio OX=7955 GN=cox1 PE=1 SV=1
14	Q8SPQ9	0.0	1163	604	0.901	0.901	Q8SPQ9_CANLF Cyclooxygenase 2 OS=Canis lupus familiaris OX=9615 GN=COX-2 PE=2 SV=1
15	Q9TT27	8.76e-89	275	204	0.220	0.652	Q9TT27_PIG Cyclooxygenase-1 (Fragment) OS=Sus scrofa OX=9823 GN=COX-1 PE=2 SV=1
16	Q4WY82	2.06e-26	117	1121	0.210	0.113	PPOC_ASPFU Linoleate 10R-lipoxygenase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ppoC PE=1 SV=2
17	G5EAZ5	1.08e-23	108	1117	0.202	0.109	G5EAZ5_EMENI Uncharacterized protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05028 PE=4 SV=1
18	Q4WPX2	1.23e-22	105	1079	0.161	0.090	PPOA_ASPFU Psi-producing oxygenase A OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=ppoA PE=2 SV=1
19	G5EB19	5.01e-21	100	1081	0.162	0.091	PPOA_EMENI Psi-producing oxygenase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ppoA PE=3 SV=1
20	Q6TMK4	1.52e-15	82.0	531	0.124	0.141	POXA_DICDI Peroxinectin A OS=Dictyostelium discoideum OX=44689 GN=poxA PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03098 An_peroxidase	2.5e-53	193.1	Animal haem peroxidase
2	PF00008 EGF	0.22	23.2	EGF-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356438

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000342385	0.998	Prostaglandin E synthase
2	9606.ENSP00000269305	0.994	Cellular tumor antigen p53
3	9606.ENSP00000244043	0.991	Prostacyclin synthase
4	9606.ENSP00000363512	0.982	Arachidonate 5-lipoxygenase
5	9606.ENSP00000345341	0.972	Prostaglandin E synthase 2
6	9606.ENSP00000264657	0.967	Signal transducer and activator of transcription 3
7	9606.ENSP00000482075	0.964	Prostaglandin E synthase 3
8	9606.ENSP00000458832	0.961	Arachidonate 15-lipoxygenase
9	9606.ENSP00000389414	0.959	Thromboxane-A synthase
10	9606.ENSP00000251535	0.951	Arachidonate 12-lipoxygenase, 12S-type
11	9606.ENSP00000295256	0.951	Hematopoietic prostaglandin D synthase
12	9606.ENSP00000360687	0.945	Prostaglandin-H2 D-isomerase
13	9606.ENSP00000440689	0.945	Cytochrome P450 2E1
14	9606.ENSP00000263341	0.944	Interleukin-1 beta
15	9606.ENSP00000306512	0.943	Interleukin-8
16	9606.ENSP00000369530	0.939	Arachidonate 15-lipoxygenase B
17	9606.ENSP00000260682	0.938	Cytochrome P450 2C9
18	9606.ENSP00000221307	0.933	Docosahexaenoic acid omega-hydroxylase CYP4F3
19	9606.ENSP00000477567	0.931	Cytochrome P450 4F8
20	9606.ENSP00000339191	0.930	Caveolin-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016491	1.000	oxidoreductase activity
GO:0005515	0.999	protein binding
GO:0016705	0.970	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
GO:0004666	0.745	prostaglandin-endoperoxide synthase activity
GO:0004601	0.711	peroxidase activity
GO:0019899	0.590	enzyme binding
GO:0042802	0.335	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.986	response to stimulus
GO:0071704	0.981	organic substance metabolic process
GO:0051716	0.977	cellular response to stimulus
GO:0044238	0.969	primary metabolic process
GO:0042221	0.958	response to chemical
GO:0044237	0.932	cellular metabolic process
GO:0065007	0.920	biological regulation
GO:0050789	0.907	regulation of biological process
GO:0070887	0.861	cellular response to chemical stimulus
GO:0050794	0.829	regulation of cellular process
GO:0048518	0.797	positive regulation of biological process
GO:0006690	0.756	icosanoid metabolic process
GO:0033559	0.752	unsaturated fatty acid metabolic process
GO:0001516	0.703	prostaglandin biosynthetic process
GO:0032501	0.676	multicellular organismal process
GO:0048522	0.639	positive regulation of cellular process
GO:0010033	0.633	response to organic substance
GO:0019222	0.572	regulation of metabolic process
GO:0071310	0.553	cellular response to organic substance
GO:0048856	0.507	anatomical structure development
GO:0060255	0.480	regulation of macromolecule metabolic process
GO:0031323	0.446	regulation of cellular metabolic process
GO:0080090	0.433	regulation of primary metabolic process
GO:0048583	0.413	regulation of response to stimulus
GO:0051171	0.390	regulation of nitrogen compound metabolic process
GO:0009893	0.382	positive regulation of metabolic process
GO:0048519	0.379	negative regulation of biological process
GO:0007275	0.367	multicellular organism development
GO:0006950	0.366	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0012505	0.995	endomembrane system
GO:0043227	0.989	membrane-bounded organelle
GO:0016020	0.987	membrane
GO:0005634	0.983	nucleus
GO:0031090	0.946	organelle membrane
GO:0042175	0.746	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0071944	0.698	cell periphery
GO:0031967	0.581	organelle envelope
GO:0005886	0.541	plasma membrane
GO:0042995	0.468	cell projection
GO:0120025	0.430	plasma membrane bounded cell projection
GO:0031981	0.381	nuclear lumen
GO:0005635	0.363	nuclear envelope
GO:0032991	0.335	protein-containing complex
GO:0043005	0.311	neuron projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	1.000	Oxidoreductases.
EC:1.14.-.-	0.970	Acting on paired donors, with incorporation or reduction of molecular oxygen. The oxygen incorporated need not be derived from O2.
RHEA:23728	0.745	(5Z,8Z,11Z,14Z)-eicosatetraenoate + AH2 + 2 O2 = A + H2O + prostaglandin H2
EC:1.14.99.1	0.745	prostaglandin-endoperoxide synthase.
EC:1.11.1.-	0.711	Peroxidases.

[back to server]