StarFunc result for job id P35398

User Input

>input (523 residues)
MESAPAAPDPAASEPGSSGADAAAGSRETPLNQESARKSEPPAPVRRQSYSSTSRGISVT
KKTHTSQIEIIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQSNATYSCPRQKNCLIDRT
SRNRCQHCRLQKCLAVGMSRDAVKFGRMSKKQRDSLYAEVQKHRMQQQQRDHQQQPGEAE
PLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIK
PEPICDYTPASGFFPYCSFTNGETSPTVSMAELEHLAQNISKSHLETCQYLREELQQITW
QTFLQEEIENYQNKQREVMWQLCAIKITEAIQYVVEFAKRIDGFMELCQNDQIVLLKAGS
LEVVFIRMCRAFDSQNNTVYFDGKYASPDVFKSLGCEDFISFVFEFGKSLCSMHLTEDEI
ALFSAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRAL
CGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35398	1.000	1.000	9.306E-70	523	1.000	1.000	P35398.pdb.gz	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
2	AFDB:A0A0C4DFP5	0.524	0.501	2.305E-61	548	0.901	0.859	A0A0C4DFP5.pdb.gz	A0A0C4DFP5_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
3	AFDB:F1QLY4	0.560	0.620	2.171E-58	468	0.801	0.895	F1QLY4.pdb.gz	RORAA_DANRE Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2
4	AFDB:P45446	0.663	0.733	4.338E-43	470	0.539	0.600	P45446.pdb.gz	RORB_RAT Nuclear receptor ROR-beta OS=Rattus norvegicus OX=10116 GN=Rorb PE=1 SV=3
5	AFDB:P51449	0.501	0.505	4.275E-40	518	0.470	0.475	P51449.pdb.gz	RORG_HUMAN Nuclear receptor ROR-gamma OS=Homo sapiens OX=9606 GN=RORC PE=1 SV=2
6	AFDB:P51450	0.482	0.488	6.099E-39	516	0.461	0.467	P51450.pdb.gz	RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus OX=10090 GN=Rorc PE=1 SV=1
7	AFDB:P31396	0.447	0.479	8.754E-30	487	0.331	0.355	P31396.pdb.gz	HR3_DROME Probable nuclear hormone receptor HR3 OS=Drosophila melanogaster OX=7227 GN=Hr3 PE=2 SV=1
8	AFDB:P41828	0.381	0.341	4.926E-23	588	0.294	0.262	P41828.pdb.gz	NHR23_CAEEL Nuclear hormone receptor family member nhr-23 OS=Caenorhabditis elegans OX=6239 GN=nhr-23 PE=1 SV=2
9	AFDB:F1D8P2	0.330	0.299	1.213E-22	579	0.312	0.282	F1D8P2.pdb.gz	F1D8P2_HUMAN Nuclear receptor Rev-ErbA beta variant 1 OS=Homo sapiens OX=9606 GN=NR1D2 PE=2 SV=1
10	AFDB:B3DHW0	0.331	0.343	1.327E-22	504	0.302	0.313	B3DHW0.pdb.gz
11	PDB:3dzyA	0.364	0.611	1.007E-12	302	0.180	0.311	3dzyA.pdb.gz	Structure of the intact PPAR-gamma-RXR- nuclear receptor complex on DNA.
12	PDB:6fx0A	0.404	0.851	5.331E-12	238	0.134	0.294	6fx0A.pdb.gz	Structure-based design of Trifarotene (CD5789), a potent and selective RAR gamma agonist for the treatment of acne.
13	PDB:1g2nA	0.291	0.587	3.758E-5	246	0.065	0.138	1g2nA.pdb.gz	Crystal structure of the ligand-binding domain of the ultraspiracle protein USP, the ortholog of retinoid X receptors in insects.
14	PDB:7kw7F	0.318	0.594	2.608E-4	259	0.063	0.127	7kw7F.pdb.gz	Structure of Hsp90-Hsp70-Hop-GR reveals the Hsp90 client-loading mechanism.
15	PDB:5nx4A	0.090	0.142	9.928E-1	293	0.044	0.078	5nx4A.pdb.gz
16	PDB:4o9yA	0.081	0.023	1.489	2490	0.076	0.016	4o9yA.pdb.gz
17	PDB:7nd2A	0.071	0.101	1.783	330	0.075	0.118	7nd2A.pdb.gz
18	PDB:6ji1A	0.091	0.097	1.951	462	0.063	0.071	6ji1A.pdb.gz
19	PDB:5wk5A	0.065	0.115	2.041	269	0.063	0.123	5wk5A.pdb.gz
20	PDB:3lomA	0.106	0.171	2.444	288	0.075	0.135	3lomA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DFP5	0.0	963	548	0.874	0.834	A0A0C4DFP5_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
2	A0A0C4DG53	0.0	964	468	0.874	0.976	A0A0C4DG53_HUMAN RAR related orphan receptor A OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=1
3	A0A8I6A803	0.0	1071	523	0.973	0.973	A0A8I6A803_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=1
4	F1LZZ3	0.0	960	467	0.870	0.974	F1LZZ3_RAT RAR-related orphan receptor A OS=Rattus norvegicus OX=10116 GN=Rora PE=3 SV=3
5	F1QLY4	0.0	873	468	0.801	0.895	RORAA_DANRE Nuclear receptor ROR-alpha A OS=Danio rerio OX=7955 GN=roraa PE=2 SV=2
6	P35398	0.0	1095	523	1.000	1.000	RORA_HUMAN Nuclear receptor ROR-alpha OS=Homo sapiens OX=9606 GN=RORA PE=1 SV=2
7	P45446	0.0	587	470	0.560	0.623	RORB_RAT Nuclear receptor ROR-beta OS=Rattus norvegicus OX=10116 GN=Rorb PE=1 SV=3
8	P51448	0.0	1070	523	0.973	0.973	RORA_MOUSE Nuclear receptor ROR-alpha OS=Mus musculus OX=10090 GN=Rora PE=1 SV=1
9	Q8R1B8	0.0	584	470	0.560	0.623	RORB_MOUSE Nuclear receptor ROR-beta OS=Mus musculus OX=10090 GN=Rorb PE=1 SV=3
10	Q92753	0.0	587	470	0.558	0.621	RORB_HUMAN Nuclear receptor ROR-beta OS=Homo sapiens OX=9606 GN=RORB PE=1 SV=3
11	P51449	9.48e-160	466	518	0.480	0.485	RORG_HUMAN Nuclear receptor ROR-gamma OS=Homo sapiens OX=9606 GN=RORC PE=1 SV=2
12	Q6I9R9	9.48e-160	466	518	0.480	0.485	Q6I9R9_HUMAN RAR-related orphan receptor C OS=Homo sapiens OX=9606 GN=RORC PE=2 SV=1
13	A0A8I6GEH3	7.63e-157	458	508	0.484	0.498	A0A8I6GEH3_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
14	P51450	6.04e-155	454	516	0.480	0.486	RORG_MOUSE Nuclear receptor ROR-gamma OS=Mus musculus OX=10090 GN=Rorc PE=1 SV=1
15	A0A8I5ZN69	7.21e-155	454	524	0.478	0.477	A0A8I5ZN69_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
16	F1D8P6	2.43e-154	451	497	0.465	0.489	F1D8P6_HUMAN RAR-related orphan nuclear receptor variant 2 OS=Homo sapiens OX=9606 GN=NR1F3 PE=2 SV=1
17	A0A0G2QC01	2.86e-150	441	487	0.465	0.499	A0A0G2QC01_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
18	P31396	3.66e-93	294	487	0.323	0.347	HR3_DROME Probable nuclear hormone receptor HR3 OS=Drosophila melanogaster OX=7227 GN=Hr3 PE=2 SV=1
19	A0A8I6A746	5.66e-65	216	339	0.260	0.401	A0A8I6A746_RAT RAR-related orphan receptor C OS=Rattus norvegicus OX=10116 GN=Rorc PE=3 SV=1
20	P41828	1.14e-58	206	588	0.314	0.279	NHR23_CAEEL Nuclear hormone receptor family member nhr-23 OS=Caenorhabditis elegans OX=6239 GN=nhr-23 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00104 Hormone_recep	4.3e-17	74.0	Ligand-binding domain of nuclear hormone receptor
2	PF00105 zf-C4	1.5e-29	113.5	Zinc finger, C4 type (two domains)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9913.ENSBTAP00000021144

Rank	PPI partner	STRING score	Description
1	9913.ENSBTAP00000007328	0.903	K(lysine) acetyltransferase 5
2	9913.ENSBTAP00000026930	0.884	Protein Wnt
3	9913.ENSBTAP00000041645	0.824	RAR-related orphan receptor C
4	9913.ENSBTAP00000047903	0.818	Intracellular channel that mediates calcium release from the endoplasmic reticulum following stimulation by inositol 1,4,5- trisphosphate. Involved in the regulation of epithelial secretion of electrolytes and fluid through the interaction with AHCYL1 Plays a role in ER stress-induced apoptosis. Cytoplasmic calcium released from the ER triggers apoptosis by the activation of CaM kinase II, eventually leading to the activation of downstream apoptosis pathways.
5	9913.ENSBTAP00000025316	0.806	Uncharacterized protein
6	9913.ENSBTAP00000028921	0.805	Bos taurus RAR-related orphan receptor B (RORB), mRNA
7	9913.ENSBTAP00000001838	0.800	Calcium-transporting ATPase
8	9913.ENSBTAP00000008593	0.800	Key regulator of striated muscle performance by acting as the major Ca(2+) ATPase responsible for the reuptake of cytosolic Ca(2+) into the sarcoplasmic reticulum. Catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen . Contributes to calcium sequestration involved in muscular excitation/contraction.
9	9913.ENSBTAP00000019703	0.800	Calcium-transporting ATPase
10	9913.ENSBTAP00000022607	0.789	Receptor-like tyrosine kinase
11	9913.ENSBTAP00000056239	0.784	Frizzled class receptor 2
12	9913.ENSBTAP00000054302	0.772	Nuclear receptor interacting protein 1
13	9913.ENSBTAP00000026257	0.750	Bos taurus neuronal PAS domain protein 2 (NPAS2), mRNA
14	9913.ENSBTAP00000017323	0.746	Aryl hydrocarbon receptor nuclear translocator-like
15	9913.ENSBTAP00000053232	0.727	Uncharacterized protein
16	9913.ENSBTAP00000051134	0.726	Uncharacterized protein
17	9913.ENSBTAP00000023618	0.649	Nuclear factor interleukin-3-regulated protein
18	9913.ENSBTAP00000037932	0.642	Uncharacterized protein
19	9913.ENSBTAP00000027750	0.633	IRAK1BP1 protein
20	9913.ENSBTAP00000054651	0.628	Bos taurus basic helix-loop-helix family, member e41 (BHLHE41), mRNA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0008134	1.000	transcription factor binding
GO:0000987	1.000	cis-regulatory region sequence-specific DNA binding
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.985	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0098531	0.957	ligand-activated transcription factor activity
GO:0038023	0.952	signaling receptor activity
GO:0000981	0.927	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001221	0.898	transcription coregulator binding
GO:0001223	0.644	transcription coactivator binding
GO:0008289	0.567	lipid binding
GO:0004879	0.506	nuclear receptor activity
GO:0005496	0.449	steroid binding
GO:0001222	0.397	transcription corepressor binding
GO:0043167	0.309	ion binding
GO:0032934	0.305	sterol binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.945	regulation of biological process
GO:0048511	0.944	rhythmic process
GO:0010468	0.848	regulation of gene expression
GO:0007623	0.828	circadian rhythm
GO:0050794	0.819	regulation of cellular process
GO:0048518	0.760	positive regulation of biological process
GO:0009987	0.721	cellular process
GO:0080090	0.681	regulation of primary metabolic process
GO:0051171	0.646	regulation of nitrogen compound metabolic process
GO:0009889	0.644	regulation of biosynthetic process
GO:0031323	0.629	regulation of cellular metabolic process
GO:0010556	0.619	regulation of macromolecule biosynthetic process
GO:0019219	0.617	regulation of nucleobase-containing compound metabolic process
GO:0050896	0.615	response to stimulus
GO:0031326	0.614	regulation of cellular biosynthetic process
GO:0009893	0.609	positive regulation of metabolic process
GO:2001141	0.600	regulation of RNA biosynthetic process
GO:0006355	0.593	regulation of DNA-templated transcription
GO:0010604	0.571	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0031974	0.987	membrane-enclosed lumen
GO:0031981	0.978	nuclear lumen
GO:0043232	0.972	intracellular non-membrane-bounded organelle
GO:0005654	0.916	nucleoplasm
GO:0005737	0.749	cytoplasm
GO:0012505	0.385	endomembrane system
GO:0016020	0.352	membrane
GO:0005730	0.305	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]