StarFunc result for job id P35408

User Input

>input (488 residues)
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35408	1.000	1.000	9.791E-60	488	1.000	1.000	P35408.pdb.gz	PE2R4_HUMAN Prostaglandin E2 receptor EP4 subtype OS=Homo sapiens OX=9606 GN=PTGER4 PE=1 SV=1
2	AFDB:P32240	0.724	0.690	3.482E-51	513	0.879	0.836	P32240.pdb.gz	PE2R4_MOUSE Prostaglandin E2 receptor EP4 subtype OS=Mus musculus OX=10090 GN=Ptger4 PE=1 SV=1
3	AFDB:A0A0A7MA29	0.644	0.665	6.302E-38	472	0.590	0.610	A0A0A7MA29.pdb.gz	A0A0A7MA29_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 PE=2 SV=1
4	AFDB:A0PJP9	0.599	0.722	1.392E-35	403	0.533	0.645	A0PJP9.pdb.gz
5	AFDB:S6B1G5	0.552	0.555	5.315E-29	486	0.395	0.397	S6B1G5.pdb.gz	S6B1G5_DANRE Prostaglandin E receptor 4 (Subtype EP4) c OS=Danio rerio OX=7955 GN=si:ch211-234e14.2 PE=2 SV=1
6	AFDB:P43252	0.542	0.632	9.338E-20	415	0.260	0.306	P43252.pdb.gz	PI2R_MOUSE Prostacyclin receptor OS=Mus musculus OX=10090 GN=Ptgir PE=1 SV=1
7	AFDB:P43119	0.522	0.654	6.518E-19	386	0.270	0.342	P43119.pdb.gz	PI2R_HUMAN Prostacyclin receptor OS=Homo sapiens OX=9606 GN=PTGIR PE=1 SV=1
8	AFDB:D0EXE2	0.555	0.682	1.920E-15	390	0.180	0.226	D0EXE2.pdb.gz	D0EXE2_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=ptger1a PE=2 SV=1
9	AFDB:D7R7W5	0.529	0.654	2.831E-15	390	0.201	0.251	D7R7W5.pdb.gz	D7R7W5_DANRE Thromboxane A2 receptor OS=Danio rerio OX=7955 GN=FP PE=2 SV=1
10	AFDB:Q5XXP2	0.521	0.541	1.736E-14	469	0.178	0.186	Q5XXP2.pdb.gz	OPN4_PHOSU Melanopsin OS=Phodopus sungorus OX=10044 GN=OPN4 PE=2 SV=1
11	PDB:7cx2R	0.477	0.846	2.243E-13	266	0.211	0.387	7cx2R.pdb.gz	Ligand recognition, unconventional activation, and G protein coupling of the prostaglandin E 2 receptor EP2 subtype.
12	PDB:6m9tA	0.492	0.539	3.454E-13	444	0.193	0.212	6m9tA.pdb.gz	Crystal structure of misoprostol bound to the labor inducer prostaglandin E2receptor.
13	PDB:7x9cR	0.462	0.712	4.883E-10	302	0.131	0.212	7x9cR.pdb.gz
14	PDB:3aymA	0.493	0.674	6.897E-10	350	0.123	0.171	3aymA.pdb.gz	Crystallographic Analysis of the Primary Photochemical Reaction of Squid Rhodopsin
15	PDB:7wq3R	0.464	0.743	1.158E-9	289	0.119	0.201	7wq3R.pdb.gz	Molecular basis for allosteric agonism and G protein subtype selectivity of galanin receptors
16	PDB:6iblA	0.436	0.526	3.879E-9	397	0.139	0.171	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
17	PDB:7e32R	0.451	0.746	5.027E-9	285	0.127	0.218	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
18	PDB:7cmuR	0.447	0.764	5.974E-9	272	0.123	0.221	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
19	PDB:7vl9R	0.397	0.607	6.801E-9	302	0.121	0.195	7vl9R.pdb.gz	Identification and mechanism of G protein-biased ligands for chemokine receptor CCR1.
20	PDB:7jvrR	0.458	0.789	7.101E-9	269	0.135	0.245	7jvrR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A7MA29	0.0	536	472	0.598	0.619	A0A0A7MA29_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 PE=2 SV=1
2	A3QK20	0.0	518	497	0.588	0.577	A3QK20_DANRE Prostaglandin E2 receptor EP4 subtype (Fragment) OS=Danio rerio OX=7955 GN=si:dkey-204l11.6 PE=3 SV=1
3	C0HB24	0.0	541	472	0.598	0.619	C0HB24_SALSA Prostaglandin E2 receptor EP4 subtype OS=Salmo salar OX=8030 GN=PE2R4 PE=2 SV=1
4	P32240	0.0	836	513	0.883	0.840	PE2R4_MOUSE Prostaglandin E2 receptor EP4 subtype OS=Mus musculus OX=10090 GN=Ptger4 PE=1 SV=1
5	P35408	0.0	996	488	1.000	1.000	PE2R4_HUMAN Prostaglandin E2 receptor EP4 subtype OS=Homo sapiens OX=9606 GN=PTGER4 PE=1 SV=1
6	P43114	0.0	832	488	0.883	0.883	PE2R4_RAT Prostaglandin E2 receptor EP4 subtype OS=Rattus norvegicus OX=10116 GN=Ptger4 PE=2 SV=1
7	Q2N1D9	0.0	524	403	0.549	0.665	Q2N1D9_DANRE Prostaglandin E2 receptor EP4 subtype OS=Danio rerio OX=7955 GN=ptger4 PE=2 SV=1
8	S6B1G5	6.92e-110	336	486	0.369	0.370	S6B1G5_DANRE Prostaglandin E receptor 4 (Subtype EP4) c OS=Danio rerio OX=7955 GN=si:ch211-234e14.2 PE=2 SV=1
9	P43119	6.40e-54	187	386	0.250	0.316	PI2R_HUMAN Prostacyclin receptor OS=Homo sapiens OX=9606 GN=PTGIR PE=1 SV=1
10	Q5RI92	8.23e-53	183	341	0.234	0.334	Q5RI92_DANRE Prostaglandin E receptor 2b (subtype EP2) OS=Danio rerio OX=7955 GN=si:ch211-13n20.1 PE=4 SV=1
11	E7FE45	1.07e-50	178	364	0.258	0.346	E7FE45_DANRE Prostacyclin receptor OS=Danio rerio OX=7955 GN=ptgir PE=3 SV=1
12	P43252	3.15e-48	173	415	0.227	0.267	PI2R_MOUSE Prostacyclin receptor OS=Mus musculus OX=10090 GN=Ptgir PE=1 SV=1
13	Q62928	9.64e-44	159	357	0.246	0.336	PE2R2_RAT Prostaglandin E2 receptor EP2 subtype OS=Rattus norvegicus OX=10116 GN=Ptger2 PE=2 SV=1
14	Q62053	3.03e-42	155	362	0.236	0.318	PE2R2_MOUSE Prostaglandin E2 receptor EP2 subtype OS=Mus musculus OX=10090 GN=Ptger2 PE=2 SV=1
15	Q9XT82	2.06e-41	153	361	0.238	0.321	PE2R2_CANLF Prostaglandin E2 receptor EP2 subtype OS=Canis lupus familiaris OX=9615 GN=PTGER2 PE=2 SV=1
16	P70263	8.06e-38	144	357	0.203	0.277	PD2R_MOUSE Prostaglandin D2 receptor OS=Mus musculus OX=10090 GN=Ptgdr PE=2 SV=1
17	P43116	1.55e-37	143	358	0.225	0.307	PE2R2_HUMAN Prostaglandin E2 receptor EP2 subtype OS=Homo sapiens OX=9606 GN=PTGER2 PE=1 SV=2
18	Q6PFT8	5.04e-37	139	281	0.197	0.342	Q6PFT8_DANRE Prostaglandin E receptor 2 (Subtype EP2)-like OS=Danio rerio OX=7955 GN=ptger2l PE=2 SV=1
19	Q13258	1.69e-35	137	359	0.207	0.281	PD2R_HUMAN Prostaglandin D2 receptor OS=Homo sapiens OX=9606 GN=PTGDR PE=2 SV=2
20	Q9R261	5.07e-35	136	357	0.193	0.263	PD2R_RAT Prostaglandin D2 receptor OS=Rattus norvegicus OX=10116 GN=Ptgdr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	5.1e-38	142.4	7 transmembrane receptor (rhodopsin family)
2	PF10320 7TM_GPCR_Srsx	8.1	17.3	Serpentine type 7TM GPCR chemoreceptor Srsx
3	PF10328 7TM_GPCR_Srx	0.00074	30.8	Serpentine type 7TM GPCR chemoreceptor Srx
4	PF10716 NdhL	46	15.4	NADH dehydrogenase transmembrane subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302846

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000409581	0.975	Beta-arrestin-1
2	9606.ENSP00000360141	0.936	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
3	9606.ENSP00000269856	0.921	Protein fem-1 homolog A
4	9606.ENSP00000245457	0.854	Prostaglandin E2 receptor EP2 subtype
5	9606.ENSP00000356438	0.824	Prostaglandin G/H synthase 2
6	9606.ENSP00000342385	0.823	Prostaglandin E synthase
7	9606.ENSP00000386444	0.781	S-arrestin
8	9606.ENSP00000362680	0.746	Proto-oncogene tyrosine-protein kinase Src
9	9606.ENSP00000354612	0.705	Prostaglandin G/H synthase 1
10	9606.ENSP00000345341	0.683	Prostaglandin E synthase 2
11	9606.ENSP00000307508	0.659	Calretinin
12	9606.ENSP00000296522	0.649	15-hydroxyprostaglandin dehydrogenase [NAD(+)]
13	9606.ENSP00000229264	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
14	9606.ENSP00000232564	0.648	Guanine nucleotide-binding protein subunit beta-4
15	9606.ENSP00000261837	0.648	Guanine nucleotide-binding protein subunit beta-5
16	9606.ENSP00000305260	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2
17	9606.ENSP00000481878	0.648	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
18	9606.ENSP00000312999	0.645	Guanine nucleotide-binding protein G(i) subunit alpha-2
19	9606.ENSP00000343027	0.645	Guanine nucleotide-binding protein G(i) subunit alpha-1
20	9606.ENSP00000358867	0.645	Guanine nucleotide-binding protein G(k) subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004957	1.000	prostaglandin E receptor activity
GO:0005488	0.995	binding
GO:0005515	0.974	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0051716	0.997	cellular response to stimulus
GO:0050794	0.988	regulation of cellular process
GO:0007154	0.977	cell communication
GO:0048583	0.968	regulation of response to stimulus
GO:0007165	0.937	signal transduction
GO:0009605	0.924	response to external stimulus
GO:0042221	0.922	response to chemical
GO:0048519	0.919	negative regulation of biological process
GO:0007186	0.898	G protein-coupled receptor signaling pathway
GO:0048518	0.847	positive regulation of biological process
GO:0019222	0.828	regulation of metabolic process
GO:0002376	0.784	immune system process
GO:0031347	0.780	regulation of defense response
GO:0060255	0.771	regulation of macromolecule metabolic process
GO:0010033	0.770	response to organic substance
GO:0050727	0.765	regulation of inflammatory response
GO:0010468	0.759	regulation of gene expression
GO:0070887	0.745	cellular response to chemical stimulus
GO:0048522	0.719	positive regulation of cellular process
GO:0032501	0.718	multicellular organismal process
GO:0071310	0.697	cellular response to organic substance
GO:0048585	0.619	negative regulation of response to stimulus
GO:0048523	0.609	negative regulation of cellular process
GO:0040012	0.608	regulation of locomotion
GO:0033993	0.608	response to lipid
GO:0051239	0.599	regulation of multicellular organismal process
GO:0002682	0.565	regulation of immune system process
GO:0010604	0.559	positive regulation of macromolecule metabolic process
GO:0048584	0.483	positive regulation of response to stimulus
GO:0032502	0.477	developmental process
GO:0023051	0.474	regulation of signaling
GO:0010646	0.464	regulation of cell communication
GO:0048856	0.460	anatomical structure development
GO:0006950	0.451	response to stress
GO:1901700	0.435	response to oxygen-containing compound
GO:0051171	0.433	regulation of nitrogen compound metabolic process
GO:0031323	0.425	regulation of cellular metabolic process
GO:0080090	0.421	regulation of primary metabolic process
GO:0030334	0.419	regulation of cell migration
GO:0009892	0.415	negative regulation of metabolic process
GO:0031325	0.366	positive regulation of cellular metabolic process
GO:0010605	0.365	negative regulation of macromolecule metabolic process
GO:0051128	0.340	regulation of cellular component organization
GO:0051173	0.339	positive regulation of nitrogen compound metabolic process
GO:0032102	0.334	negative regulation of response to external stimulus
GO:0009966	0.321	regulation of signal transduction
GO:1901701	0.308	cellular response to oxygen-containing compound
GO:0006955	0.301	immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.885	intracellular anatomical structure
GO:0043227	0.859	membrane-bounded organelle
GO:0043229	0.719	intracellular organelle
GO:0005737	0.715	cytoplasm
GO:0043231	0.704	intracellular membrane-bounded organelle
GO:0012505	0.474	endomembrane system
GO:0005634	0.388	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]