StarFunc result for job id P35442

User Input

>input (1172 residues)
MVWRLVLLALWVWPSTQAGHQDKDTTFDLFSISNINRKTIGAKQFRGPDPGVPAYRFVRF
DYIPPVNADDLSKITKIMRQKEGFFLTAQLKQDGKSRGTLLALEGPGLSQRQFEIVSNGP
ADTLDLTYWIDGTRHVVSLEDVGLADSQWKNVTVQVAGETYSLHVGCDLIDSFALDEPFY
EHLQAEKSRMYVAKGSARESHFRGLLQNVHLVFENSVEDILSKKGCQQGQGAEINAISEN
TETLRLGPHVTTEYVGPSSERRPEVCERSCEELGNMVQELSGLHVLVNQLSENLKRVSND
NQFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTTCTCKKFKTICHQITCPPATC
ASPSFVEGECCPSCLHSVDGEEGWSPWAEWTQCSVTCGSGTQQRGRSCDVTSNTCLGPSI
QTRACSLSKCDTRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSG
RETKACQGAPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQYGGKACVGDVQER
QMCNKRSCPVDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECALVPDI
CFSTSKVPRCVNTQPGFHCLPCPPRYRGNQPVGVGLEAAKTEKQVCEPENPCKDKTHNCH
KHAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNLNLVCATNATYHCIKDNC
PHLPNSGQEDFDKDGIGDACDDDDDNDGVTDEKDNCQLLFNPRQADYDKDEVGDRCDNCP
YVHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPL
VHNPDQTDVDNDLVGDQCDNNEDIDDDGHQNNQDNCPYISNANQADHDRDGQGDACDPDD
DNDGVPDDRDNCRLVFNPDQEDLDGDGRGDICKDDFDNDNIPDIDDVCPENNAISETDFR
NFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTDR
DDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPTRAYGYSGVSLKVVNSTTGTGEHLRN
ALWHTGNTPGQVRTLWHDPRNIGWKDYTAYRWHLTHRPKTGYIRVLVHEGKQVMADSGPI
YDQTYAGGRLGLFVFSQEMVYFSDLKYECRDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JV24	0.510	0.518	0.000	1152	0.595	0.605	A0A0G2JV24.pdb.gz	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
2	AFDB:D4A2G6	0.685	0.685	0.000	1172	0.883	0.883	D4A2G6.pdb.gz	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
3	AFDB:P35442	1.000	1.000	0.000	1172	1.000	1.000	P35442.pdb.gz	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
4	AFDB:P49744	0.430	0.513	4.788E-94	980	0.347	0.415	P49744.pdb.gz	TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus OX=10116 GN=Thbs4 PE=1 SV=1
5	AFDB:Q968S4	0.420	0.464	1.399E-90	1060	0.331	0.366	Q968S4.pdb.gz	Q968S4_DROME Putative thrombospondin OS=Drosophila melanogaster OX=7227 GN=Tsp PE=2 SV=1
6	AFDB:P49746	0.429	0.525	2.637E-90	956	0.339	0.415	P49746.pdb.gz	TSP3_HUMAN Thrombospondin-3 OS=Homo sapiens OX=9606 GN=THBS3 PE=1 SV=1
7	AFDB:Q8JHW2	0.421	0.512	4.340E-89	962	0.330	0.402	Q8JHW2.pdb.gz	TSP3A_DANRE Thrombospondin-3a OS=Danio rerio OX=7955 GN=thbs3a PE=2 SV=2
8	AFDB:Q8JGW0	0.431	0.531	1.124E-88	949	0.332	0.410	Q8JGW0.pdb.gz	TSP4B_DANRE Thrombospondin-4-B OS=Danio rerio OX=7955 GN=thbs4b PE=2 SV=1
9	AFDB:P49747	0.429	0.662	2.577E-84	757	0.308	0.477	P49747.pdb.gz	COMP_HUMAN Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP PE=1 SV=2
10	AFDB:Q62919	0.164	0.234	5.266E-29	810	0.109	0.158	Q62919.pdb.gz	NELL1_RAT Protein kinase C-binding protein NELL1 OS=Rattus norvegicus OX=10116 GN=Nell1 PE=2 SV=2
11	PDB:1w0rA	0.085	0.162	1.611E-12	442	0.079	0.210	1w0rA.pdb.gz
12	PDB:4e0sB	0.065	0.081	8.542E-6	898	0.030	0.039	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
13	PDB:3t5oA	0.059	0.075	1.001E-5	871	0.025	0.033	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
14	PDB:3v0aB	0.101	0.103	2.098E-5	1150	0.021	0.022	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
15	PDB:4a5wB	0.060	0.078	2.732E-5	871	0.026	0.036	4a5wB.pdb.gz	Assembly and Regulation of the Membrane Attack Complex Based on Structures of C5B6 and Sc5B9.
16	PDB:7ufgB	0.102	0.101	2.880E-5	1182	0.024	0.024	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:7qfqA	0.108	0.099	4.170E-5	1291	0.023	0.021	7qfqA.pdb.gz
18	PDB:5jowA	0.117	0.246	4.886E-5	504	0.029	0.067	5jowA.pdb.gz
19	PDB:4uflA	0.112	0.191	1.138E-4	641	0.025	0.045	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
20	PDB:2fmdA	0.111	0.436	1.930E-4	232	0.022	0.112	2fmdA.pdb.gz	Structural basis of carbohydrate recognition by a Man(alpha1-2)Man-specific lectin from Bowringia milbraedii.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JV24	1455	1171	0.620	0.621	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
2	D4A2G6	2107	1172	0.878	0.878	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
3	F1SS26	1468	1170	0.622	0.623	F1SS26_PIG Thrombospondin 1 OS=Sus scrofa OX=9823 GN=THBS1 PE=1 SV=2
4	P07996	1467	1170	0.619	0.621	TSP1_HUMAN Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2
5	P35441	1449	1170	0.618	0.619	TSP1_MOUSE Thrombospondin-1 OS=Mus musculus OX=10090 GN=Thbs1 PE=1 SV=1
6	P35442	2425	1172	1.000	1.000	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
7	P35443	613	961	0.300	0.366	TSP4_HUMAN Thrombospondin-4 OS=Homo sapiens OX=9606 GN=THBS4 PE=1 SV=2
8	P35444	618	755	0.309	0.479	COMP_RAT Cartilage oligomeric matrix protein OS=Rattus norvegicus OX=10116 GN=Comp PE=1 SV=1
9	P49744	606	980	0.299	0.358	TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus OX=10116 GN=Thbs4 PE=1 SV=1
10	P49746	627	956	0.302	0.370	TSP3_HUMAN Thrombospondin-3 OS=Homo sapiens OX=9606 GN=THBS3 PE=1 SV=1
11	P49747	626	757	0.309	0.478	COMP_HUMAN Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP PE=1 SV=2
12	Q03350	2110	1172	0.880	0.880	TSP2_MOUSE Thrombospondin-2 OS=Mus musculus OX=10090 GN=Thbs2 PE=1 SV=2
13	Q05895	627	956	0.300	0.368	TSP3_MOUSE Thrombospondin-3 OS=Mus musculus OX=10090 GN=Thbs3 PE=1 SV=2
14	Q71SA3	1451	1170	0.619	0.620	Q71SA3_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=2 SV=1
15	Q8JGW0	591	949	0.293	0.361	TSP4B_DANRE Thrombospondin-4-B OS=Danio rerio OX=7955 GN=thbs4b PE=2 SV=1
16	Q8JHW2	618	962	0.296	0.361	TSP3A_DANRE Thrombospondin-3a OS=Danio rerio OX=7955 GN=thbs3a PE=2 SV=2
17	Q968S4	570	1060	0.277	0.307	Q968S4_DROME Putative thrombospondin OS=Drosophila melanogaster OX=7227 GN=Tsp PE=2 SV=1
18	Q9R0G6	618	755	0.309	0.479	COMP_MOUSE Cartilage oligomeric matrix protein OS=Mus musculus OX=10090 GN=Comp PE=1 SV=2
19	Q9VM97	568	1060	0.276	0.306	Q9VM97_DROME Thrombospondin, isoform A OS=Drosophila melanogaster OX=7227 GN=Tsp PE=3 SV=2
20	Q9Z1T2	599	963	0.301	0.367	TSP4_MOUSE Thrombospondin-4 OS=Mus musculus OX=10090 GN=Thbs4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	2	19.7	Complement Clr-like EGF-like
2	PF00008 EGF	0.29	22.8	EGF-like domain
3	PF12947 EGF_3	0.00012	33.5	EGF domain
4	PF07645 EGF_CA	0.0059	28.1	Calcium-binding EGF domain
5	PF02210 Laminin_G_2	76	15.3	Laminin G domain
6	PF19030 TSP1_ADAMTS	0.019	26.5	Thrombospondin type 1 domain
7	PF19035 TSP1_CCN	38	16.0	CCN3 Nov like TSP1 domain
8	PF19028 TSP1_spondin	3.7e-14	64.1	Spondin-like TSP1 domain
9	PF00090 TSP_1	2e-40	148.0	Thrombospondin type 1 domain
10	PF02412 TSP_3	1.7e-49	176.4	Thrombospondin type 3 repeat
11	PF05735 TSP_C	3.6e-91	315.9	Thrombospondin C-terminal region
12	PF00093 VWC	2.2e-09	48.8	von Willebrand factor type C domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355751

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355361	0.994	Leukocyte surface antigen CD47
2	9606.ENSP00000219070	0.971	72 kDa type IV collagenase
3	9606.ENSP00000343002	0.935	Beta-1,3-glucosyltransferase
4	9606.ENSP00000369921	0.935	ADAMTS-like protein 1
5	9606.ENSP00000284984	0.930	A disintegrin and metalloproteinase with thrombospondin motifs 1
6	9606.ENSP00000243077	0.926	Prolow-density lipoprotein receptor-related protein 1
7	9606.ENSP00000251582	0.926	A disintegrin and metalloproteinase with thrombospondin motifs 2
8	9606.ENSP00000284987	0.926	A disintegrin and metalloproteinase with thrombospondin motifs 5
9	9606.ENSP00000422554	0.926	A disintegrin and metalloproteinase with thrombospondin motifs 12
10	9606.ENSP00000379350	0.925	Integrin beta-1
11	9606.ENSP00000380227	0.921	Integrin alpha-4
12	9606.ENSP00000373472	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 7
13	9606.ENSP00000418735	0.920	A disintegrin and metalloproteinase with thrombospondin motifs 9
14	9606.ENSP00000360997	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 13
15	9606.ENSP00000362304	0.919	A disintegrin and metalloproteinase with thrombospondin motifs 14
16	9606.ENSP00000258613	0.918	Thrombospondin type-1 domain-containing protein 1
17	9606.ENSP00000483599	0.918	Spondin-2
18	9606.ENSP00000286744	0.917	ADAMTS-like protein 3
19	9606.ENSP00000257359	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 8
20	9606.ENSP00000356975	0.916	A disintegrin and metalloproteinase with thrombospondin motifs 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0008201	0.997	heparin binding
GO:0005102	0.797	signaling receptor binding
GO:0044877	0.546	protein-containing complex binding
GO:0005178	0.477	integrin binding
GO:0019955	0.436	cytokine binding
GO:0050840	0.373	extracellular matrix binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0045765	0.988	regulation of angiogenesis
GO:1901343	0.987	negative regulation of vasculature development
GO:0016525	0.966	negative regulation of angiogenesis
GO:0050794	0.802	regulation of cellular process
GO:0009987	0.801	cellular process
GO:0048518	0.578	positive regulation of biological process
GO:0050896	0.566	response to stimulus
GO:0032501	0.496	multicellular organismal process
GO:0032502	0.477	developmental process
GO:0048522	0.446	positive regulation of cellular process
GO:0048856	0.444	anatomical structure development
GO:0019222	0.372	regulation of metabolic process
GO:0051716	0.348	cellular response to stimulus
GO:0007275	0.339	multicellular organism development
GO:0048523	0.331	negative regulation of cellular process
GO:0060255	0.326	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.999	collagen-containing extracellular matrix
GO:0012505	0.995	endomembrane system
GO:0005576	0.990	extracellular region
GO:0005737	0.985	cytoplasm
GO:0043227	0.969	membrane-bounded organelle
GO:0043231	0.961	intracellular membrane-bounded organelle
GO:0005615	0.911	extracellular space
GO:0031982	0.832	vesicle
GO:0070013	0.702	intracellular organelle lumen
GO:0031410	0.607	cytoplasmic vesicle
GO:0030141	0.349	secretory granule
GO:0031091	0.309	platelet alpha granule

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]