StarFunc result for job id P35443

User Input

>input (961 residues)
MLAPRGAAVLLLHLVLQRWLAAGAQATPQVFDLLPSSSQRLNPGALLPVLTDPALNDLYV
ISTFKLQTKSSATIFGLYSSTDNSKYFEFTVMGRLNKAILRYLKNDGKVHLVVFNNLQLA
DGRRHRILLRLSNLQRGAGSLELYLDCIQVDSVHNLPRAFAGPSQKPETIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLKFQSPTPSTVVPPAPPAPPTRPPRRCDSNPCFRGVQ
CTDSRDGFQCGPCPEGYTGNGITCIDVDECKYHPCYPGVHCINLSPGFRCDACPVGFTGP
MVQGVGISFAKSNKQVCTDIDECRNGACVPNSICVNTLGSYRCGPCKPGYTGDQIRGCKA
ERNCRNPELNPCSVNAQCIEERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLIHNVDQRNSDKDIFG
DACDNCLSVLNNDQKDTDGDGRGDACDDDMDGDGIKNILDNCPKFPNRDQRDKDGDGVGD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNSDGVGDICESDFDQDQVIDRIDVCP
ENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRFD
N

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P49744	0.804	0.790	0.000	980	0.925	0.907	P49744.pdb.gz	TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus OX=10116 GN=Thbs4 PE=1 SV=1
2	AFDB:P49746	0.603	0.606	0.000	956	0.605	0.608	P49746.pdb.gz	TSP3_HUMAN Thrombospondin-3 OS=Homo sapiens OX=9606 GN=THBS3 PE=1 SV=1
3	AFDB:P49747	0.549	0.696	0.000	757	0.541	0.687	P49747.pdb.gz	COMP_HUMAN Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP PE=1 SV=2
4	AFDB:Q8JGW0	0.587	0.594	0.000	949	0.686	0.694	Q8JGW0.pdb.gz	TSP4B_DANRE Thrombospondin-4-B OS=Danio rerio OX=7955 GN=thbs4b PE=2 SV=1
5	AFDB:Q8JHW2	0.596	0.596	0.000	962	0.596	0.596	Q8JHW2.pdb.gz	TSP3A_DANRE Thrombospondin-3a OS=Danio rerio OX=7955 GN=thbs3a PE=2 SV=2
6	AFDB:Q968S4	0.545	0.496	1.213E-97	1060	0.425	0.385	Q968S4.pdb.gz	Q968S4_DROME Putative thrombospondin OS=Drosophila melanogaster OX=7227 GN=Tsp PE=2 SV=1
7	AFDB:D4A2G6	0.526	0.433	7.178E-94	1172	0.410	0.336	D4A2G6.pdb.gz	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
8	AFDB:P35442	0.522	0.429	1.528E-93	1172	0.419	0.344	P35442.pdb.gz	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
9	AFDB:A0A0G2JV24	0.519	0.434	2.302E-88	1152	0.412	0.344	A0A0G2JV24.pdb.gz	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
10	AFDB:Q61220	0.145	0.168	9.602E-21	819	0.114	0.134	Q61220.pdb.gz	NELL2_MOUSE Protein kinase C-binding protein NELL2 OS=Mus musculus OX=10090 GN=Nell2 PE=1 SV=3
11	PDB:2fmdA	0.111	0.350	1.036E-5	232	0.034	0.142	2fmdA.pdb.gz	Structural basis of carbohydrate recognition by a Man(alpha1-2)Man-specific lectin from Bowringia milbraedii.
12	PDB:3ipvA	0.138	0.437	1.683E-5	249	0.028	0.108	3ipvA.pdb.gz	X-ray structure of a galactose-specific lectin from Spatholobous parviflorous
13	PDB:7qfqA	0.135	0.103	4.692E-5	1291	0.024	0.018	7qfqA.pdb.gz
14	PDB:3v0aB	0.121	0.102	5.516E-5	1150	0.018	0.015	3v0aB.pdb.gz	Botulinum neurotoxin is shielded by NTNHA in an interlocked complex.
15	PDB:3ffzA	0.105	0.084	9.986E-5	1246	0.022	0.017	3ffzA.pdb.gz	Domain organization in Clostridium botulinum neurotoxin type E is unique: its implication in faster translocation.
16	PDB:7ufgB	0.122	0.101	1.808E-4	1182	0.026	0.021	7ufgB.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
17	PDB:5xg7A	0.103	0.516	2.014E-4	139	0.018	0.122	5xg7A.pdb.gz
18	PDB:6l6aA	0.091	0.409	3.454E-4	142	0.019	0.127	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
19	PDB:3o12A	0.145	0.631	3.645E-4	185	0.014	0.070	3o12A.pdb.gz
20	PDB:5n0cA	0.109	0.083	3.847E-4	1293	0.023	0.017	5n0cA.pdb.gz	The structure of the tetanus toxin reveals pH-mediated domain dynamics.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JV24	573	1171	0.343	0.282	A0A0G2JV24_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=1 SV=2
2	B7Z030	612	651	0.355	0.524	B7Z030_DROME Thrombospondin, isoform G OS=Drosophila melanogaster OX=7227 GN=Tsp PE=3 SV=1
3	D4A2G6	601	1172	0.355	0.291	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
4	F1SS26	605	1170	0.366	0.301	F1SS26_PIG Thrombospondin 1 OS=Sus scrofa OX=9823 GN=THBS1 PE=1 SV=2
5	P07996	578	1170	0.347	0.285	TSP1_HUMAN Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1 PE=1 SV=2
6	P35441	576	1170	0.345	0.284	TSP1_MOUSE Thrombospondin-1 OS=Mus musculus OX=10090 GN=Thbs1 PE=1 SV=1
7	P35442	595	1172	0.360	0.295	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
8	P35443	1969	961	1.000	1.000	TSP4_HUMAN Thrombospondin-4 OS=Homo sapiens OX=9606 GN=THBS4 PE=1 SV=2
9	P35444	987	755	0.536	0.682	COMP_RAT Cartilage oligomeric matrix protein OS=Rattus norvegicus OX=10116 GN=Comp PE=1 SV=1
10	P49744	1742	980	0.925	0.907	TSP4_RAT Thrombospondin-4 OS=Rattus norvegicus OX=10116 GN=Thbs4 PE=1 SV=1
11	P49746	1106	956	0.600	0.604	TSP3_HUMAN Thrombospondin-3 OS=Homo sapiens OX=9606 GN=THBS3 PE=1 SV=1
12	P49747	985	757	0.535	0.679	COMP_HUMAN Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP PE=1 SV=2
13	Q03350	598	1172	0.353	0.289	TSP2_MOUSE Thrombospondin-2 OS=Mus musculus OX=10090 GN=Thbs2 PE=1 SV=2
14	Q05895	1096	956	0.595	0.598	TSP3_MOUSE Thrombospondin-3 OS=Mus musculus OX=10090 GN=Thbs3 PE=1 SV=2
15	Q71SA3	569	1170	0.341	0.280	Q71SA3_RAT Thrombospondin 1 OS=Rattus norvegicus OX=10116 GN=Thbs1 PE=2 SV=1
16	Q8JGW0	1250	949	0.688	0.697	TSP4B_DANRE Thrombospondin-4-B OS=Danio rerio OX=7955 GN=thbs4b PE=2 SV=1
17	Q8JHW2	1095	962	0.595	0.595	TSP3A_DANRE Thrombospondin-3a OS=Danio rerio OX=7955 GN=thbs3a PE=2 SV=2
18	Q968S4	632	1060	0.388	0.352	Q968S4_DROME Putative thrombospondin OS=Drosophila melanogaster OX=7227 GN=Tsp PE=2 SV=1
19	Q9R0G6	994	755	0.539	0.686	COMP_MOUSE Cartilage oligomeric matrix protein OS=Mus musculus OX=10090 GN=Comp PE=1 SV=2
20	Q9VM97	630	1060	0.365	0.331	Q9VM97_DROME Thrombospondin, isoform A OS=Drosophila melanogaster OX=7227 GN=Tsp PE=3 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	0.00062	30.9	Complement Clr-like EGF-like
2	PF11598 COMP	2e-18	77.8	Cartilage oligomeric matrix protein
3	PF00008 EGF	1.9	20.2	EGF-like domain
4	PF12947 EGF_3	0.00092	30.7	EGF domain
5	PF07645 EGF_CA	6.4e-11	53.6	Calcium-binding EGF domain
6	PF02412 TSP_3	1.2e-52	186.5	Thrombospondin type 3 repeat
7	PF05735 TSP_C	7e-93	321.5	Thrombospondin C-terminal region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339730

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355361	0.931	Leukocyte surface antigen CD47
2	9606.ENSP00000356919	0.906	Cyclic AMP-dependent transcription factor ATF-6 alpha
3	9606.ENSP00000478059	0.860	Stromal interaction molecule 1
4	9606.ENSP00000399421	0.833	Platelet glycoprotein 4
5	9606.ENSP00000296585	0.778	Integrin alpha-2
6	9606.ENSP00000379350	0.773	Integrin beta-1
7	9606.ENSP00000282588	0.742	Integrin alpha-1
8	9606.ENSP00000319635	0.720	C-X-C chemokine receptor type 2
9	9606.ENSP00000355180	0.720	Collagen alpha-1(VI) chain
10	9606.ENSP00000358310	0.714	Integrin alpha-10
11	9606.ENSP00000362122	0.694	Tenomodulin
12	9606.ENSP00000367316	0.689	Integrin alpha-8
13	9606.ENSP00000261183	0.678	Oxysterol-binding protein-related protein 8
14	9606.ENSP00000327290	0.677	Integrin alpha-11
15	9606.ENSP00000295550	0.672	Collagen alpha-3(VI) chain
16	9606.ENSP00000361818	0.667	Syndecan-4
17	9606.ENSP00000386896	0.667	Integrin alpha-6
18	9606.ENSP00000007722	0.660	Integrin alpha-3
19	9606.ENSP00000293379	0.659	Integrin alpha-5
20	9606.ENSP00000283249	0.658	Integrin beta-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0050839	0.999	cell adhesion molecule binding
GO:0005102	0.998	signaling receptor binding
GO:1901681	0.992	sulfur compound binding
GO:0097367	0.972	carbohydrate derivative binding
GO:0005539	0.955	glycosaminoglycan binding
GO:0008201	0.949	heparin binding
GO:0005518	0.885	collagen binding
GO:0043167	0.860	ion binding
GO:0043169	0.812	cation binding
GO:0005178	0.803	integrin binding
GO:0046872	0.781	metal ion binding
GO:0005509	0.681	calcium ion binding
GO:0050840	0.595	extracellular matrix binding
GO:0043236	0.586	laminin binding
GO:0042802	0.585	identical protein binding
GO:0001968	0.577	fibronectin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.994	multicellular organismal process
GO:0050789	0.993	regulation of biological process
GO:0009987	0.992	cellular process
GO:0051239	0.970	regulation of multicellular organismal process
GO:0050794	0.970	regulation of cellular process
GO:0048856	0.949	anatomical structure development
GO:0048518	0.906	positive regulation of biological process
GO:1901342	0.896	regulation of vasculature development
GO:0050896	0.876	response to stimulus
GO:0030334	0.839	regulation of cell migration
GO:0048522	0.829	positive regulation of cellular process
GO:0019222	0.778	regulation of metabolic process
GO:0051716	0.776	cellular response to stimulus
GO:0048519	0.773	negative regulation of biological process
GO:0048583	0.749	regulation of response to stimulus
GO:0002682	0.696	regulation of immune system process
GO:0006950	0.632	response to stress
GO:0060255	0.618	regulation of macromolecule metabolic process
GO:0007275	0.615	multicellular organism development
GO:0007155	0.582	cell adhesion
GO:0022603	0.568	regulation of anatomical structure morphogenesis
GO:0032101	0.538	regulation of response to external stimulus
GO:0050920	0.508	regulation of chemotaxis
GO:0045765	0.505	regulation of angiogenesis
GO:0040017	0.483	positive regulation of locomotion
GO:0048513	0.438	animal organ development
GO:0034103	0.431	regulation of tissue remodeling
GO:0031323	0.428	regulation of cellular metabolic process
GO:0080090	0.427	regulation of primary metabolic process
GO:0051171	0.427	regulation of nitrogen compound metabolic process
GO:0009653	0.420	anatomical structure morphogenesis
GO:0009893	0.415	positive regulation of metabolic process
GO:0010604	0.397	positive regulation of macromolecule metabolic process
GO:0016525	0.366	negative regulation of angiogenesis
GO:0042127	0.348	regulation of cell population proliferation
GO:0033555	0.331	multicellular organismal response to stress
GO:0071840	0.326	cellular component organization or biogenesis
GO:0048584	0.322	positive regulation of response to stimulus
GO:0007154	0.311	cell communication
GO:0023052	0.308	signaling
GO:0007165	0.301	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0043227	0.998	membrane-bounded organelle
GO:0062023	0.995	collagen-containing extracellular matrix
GO:0005615	0.990	extracellular space
GO:0043231	0.965	intracellular membrane-bounded organelle
GO:0005737	0.937	cytoplasm
GO:0012505	0.935	endomembrane system
GO:0031982	0.897	vesicle
GO:0070062	0.889	extracellular exosome
GO:0032991	0.771	protein-containing complex
GO:0016020	0.600	membrane
GO:0005783	0.597	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]