StarFunc result for job id P35453

User Input

>input (343 residues)
MSRAGSWDMDGLRADGGGAGGAPASSSSSSVAAAAASGQCRGFLSAPVFAGTHSGRAAAA
AAAAAAAAAAASGFAYPGTSERTGSSSSSSSSAVVAARPEAPPAKECPAPTPAAAAAAPP
SAPALGYGYHFGNGYYSCRMSHGVGLQQNALKSSPHASLGGFPVEKYMDVSGLASSSVPA
NEVPARAKEVSFYQGYTSPYQHVPGYIDMVSTFGSGEPRHEAYISMEGYQSWTLANGWNS
QVYCTKDQPQGSHFWKSSFPGDVALNQPDMCVYRRGRKKRVPYTKLQLKELENEYAINKF
INKDKRRRISAATNLSERQVTIWFQNRRVKDKKIVSKLKDTVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35453	0.999	0.999	7.832E-48	343	1.000	1.000	P35453.pdb.gz	HXD13_HUMAN Homeobox protein Hox-D13 OS=Homo sapiens OX=9606 GN=HOXD13 PE=1 SV=3
2	AFDB:P31276	0.267	0.277	7.130E-19	330	0.440	0.458	P31276.pdb.gz	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
3	AFDB:P09085	0.190	0.154	7.784E-5	427	0.216	0.173	P09085.pdb.gz	CAD_DROME Homeotic protein caudal OS=Drosophila melanogaster OX=7227 GN=cad PE=1 SV=4
4	PDB:4egcA	0.144	0.092	6.516E-3	539	0.047	0.030	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
5	AFDB:Q6XBJ3	0.155	0.106	1.537E-2	505	0.216	0.147	Q6XBJ3.pdb.gz	ONEC2_MOUSE One cut domain family member 2 OS=Mus musculus OX=10090 GN=Onecut2 PE=2 SV=2
6	PDB:2hi3A	0.130	0.538	1.927E-2	73	0.041	0.192	2hi3A.pdb.gz
7	AFDB:Q4VXL4	0.082	0.056	4.553E-1	575	0.172	0.103	Q4VXL4.pdb.gz	Q4VXL4_HUMAN HCG41426, isoform CRA_c OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=1
8	PDB:7fbyA	0.111	0.222	4.656E-1	153	0.029	0.065	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
9	AFDB:O18381	0.192	0.082	4.872E-1	857	0.155	0.062	O18381.pdb.gz	PAX6_DROME Paired box protein Pax-6 OS=Drosophila melanogaster OX=7227 GN=ey PE=1 SV=3
10	PDB:3ndbB	0.126	0.105	8.007E-1	420	0.032	0.026	3ndbB.pdb.gz	Structural basis of signal-sequence recognition by the signal recognition particle.
11	PDB:2cyyA	0.115	0.232	9.813E-1	151	0.032	0.073	2cyyA.pdb.gz	Crystal structure of PH1519 from Pyrococcus horikosii OT3
12	AFDB:Q9UKL3	0.157	0.030	1.099	1982	0.134	0.023	Q9UKL3.pdb.gz	C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens OX=9606 GN=CASP8AP2 PE=1 SV=1
13	PDB:4ldzA	0.125	0.199	1.577	196	0.029	0.051	4ldzA.pdb.gz	Allosteric activation of bacterial response regulators: the role of the cognate histidine kinase beyond phosphorylation.
14	PDB:7dcoL	0.119	0.096	1.932	435	0.035	0.028	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
15	PDB:2ffhA	0.128	0.110	2.068	407	0.032	0.027	2ffhA.pdb.gz
16	PDB:5nr5A	0.118	0.320	2.068	113	0.029	0.088	5nr5A.pdb.gz
17	PDB:2cjjA	0.138	0.585	2.213	63	0.029	0.159	2cjjA.pdb.gz
18	AFDB:R9PY21	0.085	0.048	2.315	720	0.169	0.081	R9PY21.pdb.gz	R9PY21_DROME Sp1, isoform E OS=Drosophila melanogaster OX=7227 GN=Sp1 PE=4 SV=1
19	AFDB:A2VEG3	0.077	0.038	3.036	851	0.192	0.078	A2VEG3.pdb.gz	A2VEG3_DROME IP16294p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8671 PE=2 SV=1
20	AFDB:Q5NCP0	0.064	0.033	3.477	784	0.146	0.064	Q5NCP0.pdb.gz	RNF43_MOUSE E3 ubiquitin-protein ligase RNF43 OS=Mus musculus OX=10090 GN=Rnf43 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ACD0	0.0	562	339	0.918	0.929	D4ACD0_RAT Homeo box D13 OS=Rattus norvegicus OX=10116 GN=Hoxd13 PE=3 SV=3
2	P35453	0.0	700	343	1.000	1.000	HXD13_HUMAN Homeobox protein Hox-D13 OS=Homo sapiens OX=9606 GN=HOXD13 PE=1 SV=3
3	P70217	0.0	562	339	0.918	0.929	HXD13_MOUSE Homeobox protein Hox-D13 OS=Mus musculus OX=10090 GN=Hoxd13 PE=1 SV=2
4	Q6JIY5	5.25e-86	263	306	0.402	0.451	HXCDA_DANRE Homeobox protein Hox-C13a OS=Danio rerio OX=7955 GN=hoxc13a PE=2 SV=1
5	Q6JIY4	1.02e-78	243	273	0.402	0.505	HXCDB_DANRE Homeobox protein Hox-C13b OS=Danio rerio OX=7955 GN=hoxc13b PE=2 SV=1
6	P31276	2.07e-76	239	330	0.347	0.361	HXC13_HUMAN Homeobox protein Hox-C13 OS=Homo sapiens OX=9606 GN=HOXC13 PE=1 SV=3
7	P50207	6.01e-76	238	328	0.353	0.369	HXC13_MOUSE Homeobox protein Hox-C13 OS=Mus musculus OX=10090 GN=Hoxc13 PE=2 SV=2
8	A0A0G2K6K0	2.78e-73	233	386	0.417	0.370	A0A0G2K6K0_RAT Homeo box A13 OS=Rattus norvegicus OX=10116 GN=Hoxa13 PE=3 SV=2
9	Q62424	2.78e-73	233	386	0.417	0.370	HXA13_MOUSE Homeobox protein Hox-A13 OS=Mus musculus OX=10090 GN=Hoxa13 PE=1 SV=1
10	P31271	4.33e-73	233	388	0.411	0.363	HXA13_HUMAN Homeobox protein Hox-A13 OS=Homo sapiens OX=9606 GN=HOXA13 PE=1 SV=3
11	P79724	4.35e-73	229	289	0.414	0.491	HXADB_DANRE Homeobox protein Hox-A13b OS=Danio rerio OX=7955 GN=hoxa13b PE=2 SV=3
12	Q6W990	1.07e-68	219	310	0.341	0.377	HXADA_DANRE Homeobox protein Hox-A13a OS=Danio rerio OX=7955 GN=hoxa13a PE=3 SV=2
13	Q92826	7.37e-62	201	284	0.294	0.356	HXB13_HUMAN Homeobox protein Hox-B13 OS=Homo sapiens OX=9606 GN=HOXB13 PE=1 SV=2
14	D3ZWL5	1.35e-61	200	286	0.300	0.360	D3ZWL5_RAT Homeo box B13 OS=Rattus norvegicus OX=10116 GN=Hoxb13 PE=3 SV=1
15	P70321	1.73e-61	200	286	0.271	0.325	HXB13_MOUSE Homeobox protein Hox-B13 OS=Mus musculus OX=10090 GN=Hoxb13 PE=2 SV=1
16	P23812	1.89e-20	91.7	268	0.108	0.138	HXD12_MOUSE Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2
17	P35452	2.89e-20	90.9	270	0.108	0.137	HXD12_HUMAN Homeobox protein Hox-D12 OS=Homo sapiens OX=9606 GN=HOXD12 PE=1 SV=3
18	O43248	6.77e-19	87.8	304	0.102	0.115	HXC11_HUMAN Homeobox protein Hox-C11 OS=Homo sapiens OX=9606 GN=HOXC11 PE=1 SV=1
19	P31277	8.11e-19	88.2	338	0.105	0.107	HXD11_HUMAN Homeobox protein Hox-D11 OS=Homo sapiens OX=9606 GN=HOXD11 PE=3 SV=3
20	P23813	9.42e-19	87.8	323	0.105	0.111	HXD11_MOUSE Homeobox protein Hox-D11 OS=Mus musculus OX=10090 GN=Hoxd11 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	6.6	18.1	Homeobox KN domain
2	PF00046 Homeodomain	1.5e-14	64.9	Homeodomain
3	PF12284 HoxA13_N	2.4e-12	58.9	Hox protein A13 N terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376322

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370989	0.959	Programmed cell death 1 ligand 1
2	9606.ENSP00000209728	0.835	Cell division control protein 6 homolog
3	9606.ENSP00000441954	0.780	Mothers against decapentaplegic homolog 5
4	9606.ENSP00000265295	0.747	Protein Spindly
5	9606.ENSP00000316032	0.747	Nuclear pore complex protein Nup98-Nup96
6	9606.ENSP00000379258	0.736	Transcriptional activator GLI3
7	9606.ENSP00000272369	0.733	Homeobox protein Meis1
8	9606.ENSP00000352565	0.700	Heart- and neural crest derivatives-expressed protein 2
9	9606.ENSP00000460971	0.693	Zona pellucida sperm-binding protein 2
10	9606.ENSP00000321797	0.676	Fibroblast growth factor 8
11	9606.ENSP00000297261	0.673	Sonic hedgehog protein
12	9606.ENSP00000326604	0.666	Limb region 1 protein homolog
13	9606.ENSP00000408617	0.640	Histone deacetylase 9
14	9606.ENSP00000390436	0.621	Zinc finger protein GLI2
15	9606.ENSP00000332744	0.600	Homeobox protein aristaless-like 4
16	9606.ENSP00000240335	0.581	T-box transcription factor TBX4
17	9606.ENSP00000249504	0.580	Homeobox protein Hox-D11
18	9606.ENSP00000331544	0.580	Fibulin-1
19	9606.ENSP00000280606	0.579	Serine protease 53
20	9606.ENSP00000249501	0.571	Homeobox protein Hox-D10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0005515	0.935	protein binding
GO:0001067	0.775	transcription regulatory region nucleic acid binding
GO:0000976	0.774	transcription cis-regulatory region binding
GO:0000977	0.546	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0048856	0.990	anatomical structure development
GO:0050794	0.990	regulation of cellular process
GO:0060255	0.977	regulation of macromolecule metabolic process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0019219	0.973	regulation of nucleobase-containing compound metabolic process
GO:0007275	0.972	multicellular organism development
GO:0010468	0.970	regulation of gene expression
GO:0009889	0.964	regulation of biosynthetic process
GO:0048518	0.944	positive regulation of biological process
GO:0006355	0.937	regulation of DNA-templated transcription
GO:0048522	0.933	positive regulation of cellular process
GO:0006357	0.921	regulation of transcription by RNA polymerase II
GO:0048731	0.913	system development
GO:0009893	0.897	positive regulation of metabolic process
GO:0010604	0.886	positive regulation of macromolecule metabolic process
GO:0048513	0.868	animal organ development
GO:0051173	0.861	positive regulation of nitrogen compound metabolic process
GO:0031325	0.859	positive regulation of cellular metabolic process
GO:0009987	0.821	cellular process
GO:0045935	0.819	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.802	positive regulation of macromolecule biosynthetic process
GO:0031328	0.802	positive regulation of cellular biosynthetic process
GO:0051254	0.782	positive regulation of RNA metabolic process
GO:0045893	0.754	positive regulation of DNA-templated transcription
GO:0009653	0.723	anatomical structure morphogenesis
GO:0045944	0.687	positive regulation of transcription by RNA polymerase II
GO:0050896	0.573	response to stimulus
GO:0001501	0.403	skeletal system development
GO:0048519	0.370	negative regulation of biological process
GO:0048523	0.303	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]