StarFunc result for job id P35475

User Input

>input (653 residues)
MRPLRPRAALLALLASLLAAPPVAPAEAPHLVHVDAARALWPLRRFWRSTGFCPPLPHSQ
ADQYVLSWDQQLNLAYVGAVPHRGIKQVRTHWLLELVTTRGSTGRGLSYNFTHLDGYLDL
LRENQLLPGFELMGSASGHFTDFEDKQQVFEWKDLVSSLARRYIGRYGLAHVSKWNFETW
NEPDHHDFDNVSMTMQGFLNYYDACSEGLRAASPALRLGGPGDSFHTPPRSPLSWGLLRH
CHDGTNFFTGEAGVRLDYISLHRKGARSSISILEQEKVVAQQIRQLFPKFADTPIYNDEA
DPLVGWSLPQPWRADVTYAAMVVKVIAQHQNLLLANTTSAFPYALLSNDNAFLSYHPHPF
AQRTLTARFQVNNTRPPHVQLLRKPVLTAMGLLALLDEEQLWAEVSQAGTVLDSNHTVGV
LASAHRPQGPADAWRAAVLIYASDDTRAHPNRSVAVTLRLRGVPPGPGLVYVTRYLDNGL
CSPDGEWRRLGRPVFPTAEQFRRMRAAEDPVAAAPRPLPAGGRLTLRPALRLPSLLLVHV
CARPEKPPGQVTRLRALPLTQGQLVLVWSDEHVGSKCLWTYEIQFSQDGKAYTPVSRKPS
TFNLFVFSPDTGAVSGSYRVRALDYWARPGPFSDPVPYLEVPVPRGPPSPGNP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZE16	0.952	0.967	0.000	643	0.769	0.781	D3ZE16.pdb.gz	D3ZE16_RAT Alpha-L-iduronidase OS=Rattus norvegicus OX=10116 GN=Idua PE=3 SV=1
2	AFDB:P35475	1.000	1.000	0.000	653	1.000	1.000	P35475.pdb.gz	IDUA_HUMAN Alpha-L-iduronidase OS=Homo sapiens OX=9606 GN=IDUA PE=1 SV=2
3	AFDB:Q9VKJ8	0.816	0.837	5.691E-52	636	0.277	0.285	Q9VKJ8.pdb.gz	IDUA_DROME Alpha-L-iduronidase OS=Drosophila melanogaster OX=7227 GN=Idua PE=1 SV=2
4	AFDB:Q9Y251	0.454	0.532	9.050E-12	543	0.124	0.149	Q9Y251.pdb.gz	HPSE_HUMAN Heparanase OS=Homo sapiens OX=9606 GN=HPSE PE=1 SV=2
5	AFDB:B2RY83	0.440	0.477	2.746E-11	592	0.116	0.128	B2RY83.pdb.gz	HPSE2_MOUSE Inactive heparanase-2 OS=Mus musculus OX=10090 GN=Hpse2 PE=2 SV=1
6	AFDB:Q71RP1	0.468	0.554	4.783E-11	536	0.124	0.151	Q71RP1.pdb.gz	HPSE_RAT Heparanase OS=Rattus norvegicus OX=10116 GN=Hpse PE=2 SV=1
7	AFDB:Q9I1N2	0.374	0.511	5.344E-11	442	0.126	0.186	Q9I1N2.pdb.gz	Q9I1N2_PSEAE PslG OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pslG PE=1 SV=1
8	PDB:5la4A	0.466	0.577	7.043E-11	508	0.107	0.138	5la4A.pdb.gz	Activity-based probes for functional interrogation of retaining beta-glucuronidases.
9	AFDB:E0SCM6	0.358	0.518	2.672E-10	413	0.083	0.131	E0SCM6.pdb.gz	E0SCM6_DICD3 Xylanase OS=Dickeya dadantii (strain 3937) OX=198628 GN=xynA PE=3 SV=1
10	PDB:2v3eA	0.393	0.487	8.557E-10	498	0.109	0.143	2v3eA.pdb.gz	Crystal Structures of Complexes of N-Butyl- and N-Nonyl-Deoxynojirimycin Bound to Acid Beta-Glucosidase: Insights Into the Mechanism of Chemical Chaperone Action in Gaucher Disease.
11	AFDB:Q9FF10	0.447	0.521	9.576E-10	543	0.101	0.122	Q9FF10.pdb.gz	HPSE1_ARATH Heparanase-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At5g07830 PE=2 SV=1
12	PDB:5bxaA	0.379	0.546	1.011E-9	414	0.112	0.176	5bxaA.pdb.gz	Characterization of the Pseudomonas aeruginosa Glycoside Hydrolase PslG Reveals That Its Levels Are Critical for Psl Polysaccharide Biosynthesis and Biofilm Formation.
13	PDB:7eyoA	0.442	0.568	3.242E-9	486	0.089	0.119	7eyoA.pdb.gz
14	AFDB:P54803	0.388	0.373	4.053E-9	685	0.126	0.120	P54803.pdb.gz	GALC_HUMAN Galactocerebrosidase OS=Homo sapiens OX=9606 GN=GALC PE=1 SV=3
15	PDB:4uflA	0.381	0.387	2.261E-8	641	0.121	0.123	4uflA.pdb.gz	Azasugar Inhibitors as Pharmacological Chaperones for Krabbe Disease.
16	PDB:2e9lA	0.310	0.413	1.413E-5	466	0.066	0.092	2e9lA.pdb.gz	Klotho-related protein is a novel cytosolic neutral beta-glycosylceramidase.
17	PDB:3lxbB	0.257	0.360	2.203E-5	396	0.081	0.134	3lxbB.pdb.gz
18	PDB:6pxvA	0.133	0.107	2.203E-5	823	0.106	0.084	6pxvA.pdb.gz
19	PDB:2xhyA	0.311	0.412	2.461E-5	470	0.057	0.079	2xhyA.pdb.gz
20	PDB:3wh9A	0.270	0.454	5.353E-5	345	0.060	0.113	3wh9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6G2G6	0.0	933	596	0.711	0.779	A0A8I6G2G6_RAT Alpha-L-iduronidase OS=Rattus norvegicus OX=10116 GN=Idua PE=3 SV=1
2	D3ZE16	0.0	1041	643	0.769	0.781	D3ZE16_RAT Alpha-L-iduronidase OS=Rattus norvegicus OX=10116 GN=Idua PE=3 SV=1
3	P35475	0.0	1327	653	1.000	1.000	IDUA_HUMAN Alpha-L-iduronidase OS=Homo sapiens OX=9606 GN=IDUA PE=1 SV=2
4	P48441	0.0	1029	634	0.755	0.778	IDUA_MOUSE Alpha-L-iduronidase OS=Mus musculus OX=10090 GN=Idua PE=1 SV=2
5	Q9VKJ8	9.34e-76	256	636	0.286	0.294	IDUA_DROME Alpha-L-iduronidase OS=Drosophila melanogaster OX=7227 GN=Idua PE=1 SV=2
6	P76491	5.1	32.0	199	0.040	0.131	5DNU_ECOLI 5'-deoxynucleotidase YfbR OS=Escherichia coli (strain K12) OX=83333 GN=yfbR PE=1 SV=1
7	O22210	9.0	31.6	248	0.031	0.081	MYBC1_ARATH Transcription factor MYBC1 OS=Arabidopsis thaliana OX=3702 GN=MYBC1 PE=1 SV=1
8	Q9SG82	9.9	31.6	335	0.029	0.057	Q9SG82_ARATH Homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=T7M13.16 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01229 Glyco_hydro_39	1.9e-189	642.0	Glycosyl hydrolases family 39
2	PF15273 NHS	7.2e+02	10.5	NHS-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000247933

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339801	0.976	Iduronate 2-sulfatase
2	9606.ENSP00000264914	0.973	Arylsulfatase B
3	9606.ENSP00000314606	0.970	N-sulphoglucosamine sulphohydrolase
4	9606.ENSP00000266031	0.929	Hyaluronidase-1
5	9606.ENSP00000345849	0.927	Hyaluronidase PH-20
6	9606.ENSP00000401853	0.910	Hyaluronidase-2
7	9606.ENSP00000337425	0.908	Hyaluronidase-3
8	9606.ENSP00000223026	0.906	Hyaluronidase-4
9	9606.ENSP00000272902	0.748	Sulfatase-modifying factor 1
10	9606.ENSP00000268695	0.740	N-acetylgalactosamine-6-sulfatase
11	9606.ENSP00000225927	0.739	Alpha-N-acetylglucosaminidase
12	9606.ENSP00000302728	0.704	Beta-glucuronidase
13	9606.ENSP00000264382	0.664	Sucrase-isomaltase, intestinal
14	9606.ENSP00000447378	0.663	Maltase-glucoamylase, intestinal
15	9606.ENSP00000354721	0.624	Sulfate anion transporter 1
16	9606.ENSP00000000412	0.610	Cation-dependent mannose-6-phosphate receptor
17	9606.ENSP00000261304	0.610	Galactocerebrosidase
18	9606.ENSP00000307423	0.609	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
19	9606.ENSP00000358966	0.608	Interphotoreceptor matrix proteoglycan 1
20	9606.ENSP00000218516	0.607	Galactosidase alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003940	1.000	L-iduronidase activity
GO:0005515	0.987	protein binding
GO:0005102	0.858	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.994	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0044238	0.985	primary metabolic process
GO:0005975	0.967	carbohydrate metabolic process
GO:0009100	0.962	glycoprotein metabolic process
GO:0044248	0.934	cellular catabolic process
GO:1903510	0.894	mucopolysaccharide metabolic process
GO:0006029	0.893	proteoglycan metabolic process
GO:1901575	0.846	organic substance catabolic process
GO:0044273	0.811	sulfur compound catabolic process
GO:0044281	0.806	small molecule metabolic process
GO:0006027	0.757	glycosaminoglycan catabolic process
GO:0044282	0.698	small molecule catabolic process
GO:0006082	0.634	organic acid metabolic process
GO:0016054	0.601	organic acid catabolic process
GO:0044265	0.591	cellular macromolecule catabolic process
GO:0043436	0.578	oxoacid metabolic process
GO:0005996	0.574	monosaccharide metabolic process
GO:0046395	0.558	carboxylic acid catabolic process
GO:0006516	0.556	glycoprotein catabolic process
GO:0016052	0.552	carbohydrate catabolic process
GO:0050654	0.487	chondroitin sulfate proteoglycan metabolic process
GO:0009311	0.483	oligosaccharide metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005764	1.000	lysosome
GO:0031982	0.999	vesicle
GO:0070013	0.998	intracellular organelle lumen
GO:0043202	0.992	lysosomal lumen
GO:0005615	0.991	extracellular space
GO:0070062	0.976	extracellular exosome
GO:0031410	0.582	cytoplasmic vesicle
GO:0016020	0.401	membrane
GO:0012505	0.390	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.76	1.000	L-iduronidase.

[back to server]