StarFunc result for job id P35498

User Input

>input (2009 residues)
MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKI
AIKILVHSLFSMLIMCTILTNCVFMTMSNPPDWTKNVEYTFTGIYTFESLIKIIARGFCL
EDFTFLRDPWNWLDFTVITFAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCIQWPPTNASLEEHSIEKNITVNY
NGTLINETVFEFDWKSYIQDSRYHYFLEGFLDALLCGNSSDAGQCPEGYMCVKAGRNPNY
GYTSFDTFSWAFLSLFRLMTQDFWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLINLILA
VVAMAYEEQNQATLEEAEQKEAEFQQMIEQLKKQQEAAQQAATATASEHSREPSAAGRLS
DSSSEASKLSSKSAKERRNRRKKRKQKEQSGGEEKDEDEFQKSESEDSIRRKGFRFSIEG
NRLTYEKRYSSPHQSLLSIRGSLFSPRRNSRTSLFSFRGRAKDVGSENDFADDEHSTFED
NESRRDSLFVPRRHGERRNSNLSQTSRSSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVP
TSPVGQLLPEVIIDKPATDDNGTTTETEMRKRRSSSFHVSMDFLEDPSQRQRAMSIASIL
TNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVKHVVNLVVMDPFVDLAITICIVL
NTLFMAMEHYPMTDHFNNVLTVGNLVFTGIFTAEMFLKIIAMDPYYYFQEGWNIFDGFIV
TLSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAII
VFIFAVVGMQLFGKSYKDCVCKIASDCQLPRWHMNDFFHSFLIVFRVLCGEWIETMWDCM
EVAGQAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSADNLAATDDDNEMNNLQIAVDRMH
KGVAYVKRKIYEFIQQSFIRKQKILDEIKPLDDLNNKKDSCMSNHTAEIGKDLDYLKDVN
GTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIAVGESDFENLNTEDFSSESDLEE
SKEKLNESSSSSEGSTVDIGAPVEEQPVVEPEETLEPEACFTEGCVQRFKCCQINVEEGR
GKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFEDIYIDQRKTIKTMLEYADKVFT
YIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVSLTANALGYSELGAIKSLRTLRA
LRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTT
TGDRFDIEDVNNHTDCLKLIERNETARWKNVKVNFDNVGFGYLSLLQVATFKGWMDIMYA
AVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFM
TEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVTRQVFDISIMILICLNMVTMMV
ETDDQSEYVTTILSRINLVFIVLFTGECVLKLISLRHYYFTIGWNIFDFVVVILSIVGMF
LAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLV
MFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSKPPD
CDPNKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPL
SEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPLNLPQPNKLQLIAMDLPMVSGD
RIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPSKVSYQPITTTLKRKQEEVSAV
IIQRAYRRHLLKRTVKQASFTYNKNKIKGGANLLIKEDMIIDRINENSITEKTDLTMSTA
ACPPSYDRVTKPIVEKHEQEGKDEKAKGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6agfA	0.558	0.980	0.000	1138	0.482	0.851	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
2	PDB:6j8eA	0.559	0.980	0.000	1139	0.532	0.938	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
3	PDB:6j8gA	0.553	0.969	0.000	1140	0.484	0.853	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
4	PDB:7w9lA	0.640	0.899	0.000	1420	0.592	0.838	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
5	PDB:7xveA	0.589	0.908	0.000	1276	0.527	0.830	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
6	AFDB:A2APX8	0.895	0.895	0.000	2009	0.981	0.981	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
7	AFDB:B1AWN6	0.852	0.853	0.000	2006	0.870	0.871	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
8	AFDB:B1AYL1	0.687	0.815	0.000	1681	0.418	0.500	B1AYL1.pdb.gz	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
9	AFDB:P08104	0.818	0.841	0.000	1951	0.816	0.841	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
10	AFDB:Q01118	0.713	0.846	0.000	1682	0.444	0.531	Q01118.pdb.gz	SCN7A_HUMAN Sodium channel protein type 7 subunit alpha OS=Homo sapiens OX=9606 GN=SCN7A PE=1 SV=2
11	AFDB:Q15858	0.827	0.836	0.000	1988	0.764	0.772	Q15858.pdb.gz	SCN9A_HUMAN Sodium channel protein type 9 subunit alpha OS=Homo sapiens OX=9606 GN=SCN9A PE=1 SV=3
12	AFDB:Q9ER60	0.775	0.845	0.000	1841	0.640	0.698	Q9ER60.pdb.gz	SCN4A_MOUSE Sodium channel protein type 4 subunit alpha OS=Mus musculus OX=10090 GN=Scn4a PE=1 SV=1
13	AFDB:Q9Y5Y9	0.749	0.768	0.000	1956	0.550	0.565	Q9Y5Y9.pdb.gz	SCNAA_HUMAN Sodium channel protein type 10 subunit alpha OS=Homo sapiens OX=9606 GN=SCN10A PE=1 SV=2
14	PDB:6lqaB	0.557	0.965	5.626E-101	1151	0.447	0.780	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
15	PDB:7we4A	0.536	0.951	3.963E-100	1122	0.398	0.713	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
16	PDB:6uz3A	0.544	0.961	4.822E-96	1126	0.438	0.782	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
17	PDB:7tj9A	0.532	0.952	4.708E-82	1111	0.315	0.570	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
18	PDB:7mixA	0.526	0.782	4.758E-51	1326	0.189	0.287	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.
19	AFDB:Q91ZR5	0.109	0.305	3.038E-7	686	0.050	0.147	Q91ZR5.pdb.gz	CTSR1_MOUSE Cation channel sperm-associated protein 1 OS=Mus musculus OX=10090 GN=Catsper1 PE=1 SV=1
20	AFDB:Q9Y6F6	0.037	0.070	3.899E-1	904	0.038	0.085	Q9Y6F6.pdb.gz	IRAG1_HUMAN Inositol 1,4,5-triphosphate receptor associated 1 OS=Homo sapiens OX=9606 GN=IRAG1 PE=1 SV=4

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	2424	1962	0.629	0.644	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	2538	1955	0.657	0.675	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	3327	1618	0.800	0.993	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	4120	1998	0.993	0.998	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	1194	1915	0.289	0.303	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	4120	1997	0.994	1.000	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	2815	1939	0.741	0.768	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	1190	1672	0.307	0.369	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	4106	2009	0.982	0.982	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	3116	1947	0.812	0.838	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	3476	2006	0.863	0.864	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1240	1681	0.320	0.383	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	1164	1998	0.314	0.315	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	1162	1983	0.314	0.318	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	1212	1680	0.309	0.370	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	3072	1996	0.774	0.779	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	1162	2016	0.314	0.312	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	2419	1962	0.628	0.643	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	2961	1984	0.766	0.775	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	2910	1978	0.760	0.771	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00430 ATP-synt_B	2e+02	13.5	ATP synthase B/B' CF(0)
2	PF19745 FUT8_N_cat	2.9e+02	11.6	Alpha-(1,6)-fucosyltransferase N- and catalytic domains
3	PF16905 GPHH	0.65	21.2	Voltage-dependent L-type calcium channel, IQ-associated
4	PF00520 Ion_trans	2.9e-253	847.2	Ion transport protein
5	PF00612 IQ	44	15.2	IQ calmodulin-binding motif
6	PF06512 Na_trans_assoc	9.4e-56	200.8	Sodium ion transport-associated
7	PF11933 Na_trans_cytopl	5.6e-68	239.8	Cytoplasmic domain of voltage-gated Na+ ion channel
8	PF08016 PKD_channel	2.2e-06	38.8	Polycystin cation channel
9	PF02535 Zip	34	15.1	ZIP Zinc transporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303540

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396915	0.950	Sodium channel subunit beta-1
2	9606.ENSP00000352035	0.912	Potassium voltage-gated channel subfamily KQT member 2
3	9606.ENSP00000278947	0.910	Sodium channel subunit beta-2
4	9606.ENSP00000322460	0.901	Sodium channel subunit beta-4
5	9606.ENSP00000280772	0.884	Ankyrin-3
6	9606.ENSP00000373648	0.864	Potassium voltage-gated channel subfamily KQT member 3
7	9606.ENSP00000354490	0.862	Sodium/potassium-transporting ATPase subunit alpha-2
8	9606.ENSP00000410732	0.831	Gamma-aminobutyric acid receptor subunit gamma-2
9	9606.ENSP00000376523	0.821	Sodium channel subunit beta-3
10	9606.ENSP00000344786	0.820	Neurofascin
11	9606.ENSP00000263373	0.810	Spectrin beta chain, non-erythrocytic 4
12	9606.ENSP00000362125	0.810	Protocadherin-19
13	9606.ENSP00000309591	0.804	cAMP-dependent protein kinase catalytic subunit alpha
14	9606.ENSP00000359719	0.804	cAMP-dependent protein kinase catalytic subunit beta
15	9606.ENSP00000366488	0.804	cAMP-dependent protein kinase catalytic subunit gamma
16	9606.ENSP00000349588	0.799	Ankyrin-2
17	9606.ENSP00000361824	0.796	Spectrin alpha chain, non-erythrocytic 1
18	9606.ENSP00000371985	0.779	Potassium voltage-gated channel subfamily A member 1
19	9606.ENSP00000368314	0.767	Neuronal cell adhesion molecule
20	9606.ENSP00000356265	0.764	Neuron navigator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005488	0.911	binding
GO:0005515	0.891	protein binding
GO:0022836	0.517	gated channel activity
GO:0022839	0.469	monoatomic ion gated channel activity
GO:0046872	0.345	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0009987	0.991	cellular process
GO:0042391	0.977	regulation of membrane potential
GO:0032501	0.967	multicellular organismal process
GO:0001508	0.958	action potential
GO:0006811	0.945	monoatomic ion transport
GO:0030001	0.942	metal ion transport
GO:0050896	0.938	response to stimulus
GO:0050789	0.886	regulation of biological process
GO:0007154	0.874	cell communication
GO:0050877	0.852	nervous system process
GO:0019226	0.840	transmission of nerve impulse
GO:0006814	0.831	sodium ion transport
GO:0019228	0.581	neuronal action potential
GO:0055085	0.574	transmembrane transport
GO:0050794	0.559	regulation of cellular process
GO:0034220	0.533	monoatomic ion transmembrane transport
GO:0098660	0.488	inorganic ion transmembrane transport
GO:0098655	0.484	monoatomic cation transmembrane transport
GO:0098662	0.483	inorganic cation transmembrane transport
GO:0009628	0.372	response to abiotic stimulus
GO:0007610	0.364	behavior
GO:0051716	0.362	cellular response to stimulus
GO:0032502	0.345	developmental process
GO:0023052	0.336	signaling
GO:0048856	0.301	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.968	intracellular anatomical structure
GO:0043226	0.966	organelle
GO:0032991	0.957	protein-containing complex
GO:0043231	0.937	intracellular membrane-bounded organelle
GO:0098796	0.861	membrane protein complex
GO:1902495	0.822	transmembrane transporter complex
GO:0098797	0.799	plasma membrane protein complex
GO:0034702	0.793	ion channel complex
GO:0005634	0.756	nucleus
GO:0034703	0.710	cation channel complex
GO:0005654	0.579	nucleoplasm
GO:0034706	0.521	sodium channel complex
GO:0001518	0.325	voltage-gated sodium channel complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]