StarFunc result for job id P35499

User Input

>input (1836 residues)
MARPSLCTLVPLGPECLRPFTRESLAAIEQRAVEEEARLQRNKQMEIEEPERKPRSDLEA
GKNLPMIYGDPPPEVIGIPLEDLDPYYSNKKTFIVLNKGKAIFRFSATPALYLLSPFSVV
RRGAIKVLIHALFSMFIMITILTNCVFMTMSDPPPWSKNVEYTFTGIYTFESLIKILARG
FCVDDFTFLRDPWNWLDFSVIMMAYLTEFVDLGNISALRTFRVLRALKTITVIPGLKTIV
GALIQSVKKLSDVMILTVFCLSVFALVGLQLFMGNLRQKCVRWPPPFNDTNTTWYSNDTW
YGNDTWYGNEMWYGNDSWYANDTWNSHASWATNDTFDWDAYISDEGNFYFLEGSNDALLC
GNSSDAGHCPEGYECIKTGRNPNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAG
KTYMIFFVVIIFLGSFYLINLILAVVAMAYAEQNEATLAEDKEKEEEFQQMLEKFKKHQE
ELEKAKAAQALEGGEADGDPAHGKDCNGSLDTSQGEKGAPRQSSSGDSGISDAMEELEEA
HQKCPPWWYKCAHKVLIWNCCAPWLKFKNIIHLIVMDPFVDLGITICIVLNTLFMAMEHY
PMTEHFDNVLTVGNLVFTGIFTAEMVLKLIAMDPYEYFQQGWNIFDSIIVTLSLVELGLA
NVQGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQ
LFGKSYKECVCKIALDCNLPRWHMHDFFHSFLIVFRILCGEWIETMWDCMEVAGQAMCLT
VFLMVMVIGNLVVLNLFLALLLSSFSADSLAASDEDGEMNNLQIAIGRIKLGIGFAKAFL
LGLLHGKILSPKDIMLSLGEADGAGEAGEAGETAPEDEKKEPPEEDLKKDNHILNHMGLA
DGPPSSLELDHLNFINNPYLTIQVPIASEESDLEMPTEEETDTFSEPEDSKKPPQPLYDG
NSSVCSTADYKPPEEDPEEQAEENPEGEQPEECFTEACVQRWPCLYVDISQGRGKKWWTL
RRACFKIVEHNWFETFIVFMILLSSGALAFEDIYIEQRRVIRTILEYADKVFTYIFIMEM
LLKWVAYGFKVYFTNAWCWLDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRAL
SRFEGMRVVVNALLGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYYCINTTTSERFDI
SEVNNKSECESLMHTGQVRWLNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREKE
EQPQYEVNLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKLGGKDIFMTEEQKKYY
NAMKKLGSKKPQKPIPRPQNKIQGMVYDLVTKQAFDITIMILICLNMVTMMVETDNQSQL
KVDILYNINMIFIIIFTGECVLKMLALRQYYFTVGWNIFDFVVVILSIVGLALSDLIQKY
FVSPTLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFG
MSNFAYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPNLENP
GTSVKGDCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMF
YETWEKFDPDATQFIAYSRLSDFVDTLQEPLRIAKPNKIKLITLDLPMVPGDKIHCLDIL
FALTKEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRR
HLLQRSMKQASYMYRHSHDGSGDDAPEKEGLLANTMSKMYGHENGNSSSPSPEEKGEAGD
AGPTMGLMPISPSDTAWPPAPPPGQTVRPGVKESLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6agfA	0.612	0.983	0.000	1138	0.620	1.000	6agfA.pdb.gz	Structure of the human voltage-gated sodium channel Nav1.4 in complex with beta 1.
2	PDB:6j8eA	0.607	0.974	0.000	1139	0.534	0.860	6j8eA.pdb.gz	Molecular basis for pore blockade of human Na+channel Nav1.2 by the mu-conotoxin KIIIA.
3	PDB:6j8gA	0.600	0.960	0.000	1140	0.509	0.819	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
4	PDB:6lqaB	0.607	0.962	0.000	1151	0.491	0.784	6lqaB.pdb.gz	Structural Basis for Pore Blockade of the Human Cardiac Sodium Channel Na v 1.5 by the Antiarrhythmic Drug Quinidine*.
5	PDB:7w9lA	0.696	0.894	0.000	1420	0.615	0.795	7w9lA.pdb.gz	High-resolution structures of human Na v 1.7 reveal gating modulation through alpha-pi helical transition of S6 IV.
6	PDB:7we4A	0.589	0.956	0.000	1122	0.437	0.716	7we4A.pdb.gz	Structural basis for high-voltage activation and subtype-specific inhibition of human Na v 1.8.
7	PDB:7xveA	0.628	0.888	0.000	1276	0.547	0.787	7xveA.pdb.gz	Unwinding and spiral sliding of S4 and domain rotation of VSD during the electromechanical coupling in Na v 1.7.
8	AFDB:A0A0R4IUM7	0.829	0.779	0.000	1955	0.629	0.590	A0A0R4IUM7.pdb.gz	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
9	AFDB:A0A2R8QLY1	0.823	0.775	0.000	1949	0.675	0.636	A0A2R8QLY1.pdb.gz
10	AFDB:A2APX8	0.828	0.758	0.000	2009	0.702	0.641	A2APX8.pdb.gz	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
11	AFDB:B1AWN6	0.832	0.763	0.000	2006	0.708	0.648	B1AWN6.pdb.gz	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	AFDB:B1AYL1	0.751	0.817	0.000	1681	0.425	0.464	B1AYL1.pdb.gz	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	AFDB:F1LQQ7	0.769	0.826	0.000	1704	0.423	0.455	F1LQQ7.pdb.gz	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
14	AFDB:F1QXF5	0.833	0.767	0.000	1996	0.690	0.634	F1QXF5.pdb.gz	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
15	AFDB:O88457	0.792	0.822	0.000	1765	0.482	0.501	O88457.pdb.gz	SCNBA_RAT Sodium channel protein type 11 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn11a PE=1 SV=1
16	AFDB:P08104	0.834	0.785	0.000	1951	0.695	0.654	P08104.pdb.gz	SCN3A_RAT Sodium channel protein type 3 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn3a PE=1 SV=1
17	AFDB:P35500	0.793	0.686	0.000	2131	0.478	0.412	P35500.pdb.gz	SCNA_DROME Sodium channel protein para OS=Drosophila melanogaster OX=7227 GN=para PE=2 SV=3
18	PDB:6uz3A	0.594	0.962	3.038E-101	1126	0.484	0.789	6uz3A.pdb.gz	Structure of the Cardiac Sodium Channel.
19	PDB:7tj9A	0.580	0.949	3.557E-86	1111	0.343	0.567	7tj9A.pdb.gz	Structure-guided unlocking of Na X reveals a non-selective tetrodotoxin-sensitive cation channel.
20	PDB:7mixA	0.580	0.790	4.896E-55	1326	0.205	0.284	7mixA.pdb.gz	Structure of human Ca v 2.2 channel blocked by the painkiller ziconotide.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MT39	1739	1962	0.485	0.454	A0A0A0MT39_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
2	A0A0R4IUM7	1685	1955	0.473	0.444	A0A0R4IUM7_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=Nav1.1 PE=3 SV=2
3	A0A1B0GVX7	1291	1618	0.359	0.407	A0A1B0GVX7_HUMAN Sodium voltage-gated channel alpha subunit 1 OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
4	A0A1W2PPJ3	1840	1998	0.502	0.461	A0A1W2PPJ3_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
5	A0A286YEQ8	678	1915	0.184	0.176	A0A286YEQ8_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
6	A0A286YF26	1840	1997	0.502	0.461	A0A286YF26_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN1A PE=1 SV=1
7	A0A590UK43	1699	1939	0.477	0.451	A0A590UK43_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN8A PE=1 SV=1
8	A0A8I6GH51	1361	1672	0.414	0.455	A0A8I6GH51_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=3 SV=1
9	A2APX8	1853	2009	0.510	0.466	SCN1A_MOUSE Sodium channel protein type 1 subunit alpha OS=Mus musculus OX=10090 GN=Scn1a PE=1 SV=1
10	A2ASI5	1807	1947	0.499	0.471	SCN3A_MOUSE Sodium channel protein type 3 subunit alpha OS=Mus musculus OX=10090 GN=Scn3a PE=1 SV=1
11	B1AWN6	1873	2006	0.516	0.472	SCN2A_MOUSE Sodium channel protein type 2 subunit alpha OS=Mus musculus OX=10090 GN=Scn2a PE=1 SV=1
12	B1AYL1	1464	1681	0.433	0.473	B1AYL1_MOUSE Sodium channel protein OS=Mus musculus OX=10090 GN=Scn7a PE=1 SV=1
13	E9PG18	1677	1998	0.475	0.437	E9PG18_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
14	E9PHB6	1654	1983	0.472	0.437	E9PHB6_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
15	F1LQQ7	1432	1680	0.428	0.467	F1LQQ7_RAT Sodium channel protein OS=Rattus norvegicus OX=10116 GN=Scn7a PE=1 SV=4
16	F1QXF5	1826	1996	0.502	0.461	F1QXF5_DANRE Sodium channel protein OS=Danio rerio OX=7955 GN=scn1lab PE=3 SV=1
17	H9KVD2	1724	2016	0.485	0.441	H9KVD2_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=1 SV=1
18	K4DIA1	1739	1962	0.485	0.454	K4DIA1_HUMAN Sodium channel protein OS=Homo sapiens OX=9606 GN=SCN5A PE=3 SV=1
19	O08562	1796	1984	0.499	0.462	SCN9A_RAT Sodium channel protein type 9 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn9a PE=1 SV=1
20	O88420	1784	1978	0.498	0.462	SCN8A_RAT Sodium channel protein type 8 subunit alpha OS=Rattus norvegicus OX=10116 GN=Scn8a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16905 GPHH	5.8	18.2	Voltage-dependent L-type calcium channel, IQ-associated
2	PF00520 Ion_trans	3.1e-250	837.3	Ion transport protein
3	PF00612 IQ	19	16.4	IQ calmodulin-binding motif
4	PF14625 Lustrin_cystein	2.6e+02	13.4	Lustrin, cysteine-rich repeated domain
5	PF06512 Na_trans_assoc	1.2e-58	210.3	Sodium ion transport-associated
6	PF08016 PKD_channel	1.6e-06	39.2	Polycystin cation channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000396320

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396915	0.990	Sodium channel subunit beta-1
2	9606.ENSP00000322460	0.974	Sodium channel subunit beta-4
3	9606.ENSP00000349467	0.952	Calmodulin-1
4	9606.ENSP00000364586	0.943	Sodium channel protein type 2 subunit alpha
5	9606.ENSP00000278947	0.908	Sodium channel subunit beta-2
6	9606.ENSP00000283254	0.906	Sodium channel protein type 3 subunit alpha
7	9606.ENSP00000353292	0.904	Amiloride-sensitive sodium channel subunit alpha
8	9606.ENSP00000300061	0.902	Amiloride-sensitive sodium channel subunit gamma
9	9606.ENSP00000345751	0.902	Amiloride-sensitive sodium channel subunit beta
10	9606.ENSP00000291295	0.894	Calmodulin 3 (phosphorylase kinase, delta)
11	9606.ENSP00000376523	0.883	Sodium channel subunit beta-3
12	9606.ENSP00000272298	0.880	Calmodulin 2 (phosphorylase kinase, delta)
13	9606.ENSP00000356265	0.871	Neuron navigator 1
14	9606.ENSP00000339867	0.841	Chloride channel protein 1
15	9606.ENSP00000390600	0.778	Sodium channel protein type 10 subunit alpha
16	9606.ENSP00000252826	0.755	Transient receptor potential cation channel subfamily M member 4
17	9606.ENSP00000280772	0.755	Ankyrin-3
18	9606.ENSP00000352035	0.751	Potassium voltage-gated channel subfamily KQT member 2
19	9606.ENSP00000433109	0.737	Potassium voltage-gated channel subfamily A member 2
20	9606.ENSP00000410257	0.734	Sodium channel protein type 5 subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005248	1.000	voltage-gated sodium channel activity
GO:0005488	0.995	binding
GO:0005515	0.994	protein binding
GO:0022839	0.488	monoatomic ion gated channel activity
GO:0005244	0.338	voltage-gated monoatomic ion channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0030001	0.991	metal ion transport
GO:0009987	0.987	cellular process
GO:0006814	0.974	sodium ion transport
GO:0065007	0.957	biological regulation
GO:0098655	0.870	monoatomic cation transmembrane transport
GO:0098662	0.869	inorganic cation transmembrane transport
GO:0032501	0.807	multicellular organismal process
GO:0050789	0.801	regulation of biological process
GO:0035725	0.769	sodium ion transmembrane transport
GO:0003008	0.621	system process
GO:0042391	0.499	regulation of membrane potential
GO:0050794	0.426	regulation of cellular process
GO:0044057	0.337	regulation of system process
GO:0050896	0.314	response to stimulus
GO:0006936	0.306	muscle contraction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0034703	0.997	cation channel complex
GO:0098797	0.993	plasma membrane protein complex
GO:0034706	0.959	sodium channel complex
GO:0001518	0.944	voltage-gated sodium channel complex
GO:0043226	0.755	organelle
GO:0005622	0.711	intracellular anatomical structure
GO:0043227	0.706	membrane-bounded organelle
GO:0005737	0.666	cytoplasm
GO:0043229	0.527	intracellular organelle
GO:0043231	0.346	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]