StarFunc result for job id P35523

User Input

>input (988 residues)
MEQSRSQQRGGEQSWWGSDPQYQYMPFEHCTSYGLPSENGGLQHRLRKDAGPRHNVHPTQ
IYGHHKEQFSDREQDIGMPKKTGSSSTVDSKDEDHYSKCQDCIHRLGQVVRRKLGEDGIF
LVLLGLLMALVSWSMDYVSAKSLQAYKWSYAQMQPSLPLQFLVWVTFPLVLILFSALFCH
LISPQAVGSGIPEMKTILRGVVLKEYLTMKAFVAKVVALTAGLGSGIPVGKEGPFVHIAS
ICAAVLSKFMSVFCGVYEQPYYYSDILTVGCAVGVGCCFGTPLGGVLFSIEVTSTYFAVR
NYWRGFFAATFSAFVFRVLAVWNKDAVTITALFRTNFRMDFPFDLKELPAFAAIGICCGL
LGAVFVYLHRQVMLGVRKHKALSQFLAKHRLLYPGIVTFVIASFTFPPGMGQFMAGELMP
REAISTLFDNNTWVKHAGDPESLGQSAVWIHPRVNVVIIIFLFFVMKFWMSIVATTMPIP
CGGFMPVFVLGAAFGRLVGEIMAMLFPDGILFDDIIYKILPGGYAVIGAAALTGAVSHTV
STAVICFELTGQIAHILPMMVAVILANMVAQSLQPSLYDSIIQVKKLPYLPDLGWNQLSK
YTIFVEDIMVRDVKFVSASYTYGELRTLLQTTTVKTLPLVDSKDSMILLGSVERSELQAL
LQRHLCPERRLRAAQEMARKLSELPYDGKARLAGEGLPGAPPGRPESFAFVDEDEDEDLS
GKSELPPSLALHPSTTAPLSPEEPNGPLPGHKQQPEAPEPAGQRPSIFQSLLHCLLGRAR
PTKKKTTQDSTDLVDNMSPEEIEAWEQEQLSQPVCFDSCCIDQSPFQLVEQTTLHKTHTL
FSLLGLHLAYVTSMGKLRGVLALEELQKAIEGHTKSGVQLRPPLASFRNTTSTRKSTGAP
PSSAENWNLPEDRPGATGTGDVIAASPETPVPSPSPEPPLSLAPGKVEGELEELELVESP
GLEEELADILQGPSLRSTDEEDEDELIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35523	1.000	1.000	0.000	988	1.000	1.000	P35523.pdb.gz	CLCN1_HUMAN Chloride channel protein 1 OS=Homo sapiens OX=9606 GN=CLCN1 PE=1 SV=3
2	AFDB:P35524	0.772	0.767	0.000	994	0.882	0.876	P35524.pdb.gz	CLCN1_RAT Chloride channel protein 1 OS=Rattus norvegicus OX=10116 GN=Clcn1 PE=1 SV=1
3	AFDB:Q9R0A1	0.689	0.748	3.651E-72	908	0.475	0.517	Q9R0A1.pdb.gz	CLCN2_MOUSE Chloride channel protein 2 OS=Mus musculus OX=10090 GN=Clcn2 PE=1 SV=2
4	AFDB:A0A098DN12	0.678	0.745	5.144E-71	898	0.454	0.500	A0A098DN12.pdb.gz	A0A098DN12_DANRE Chloride channel protein 2 OS=Danio rerio OX=7955 GN=clcn2b PE=2 SV=1
5	AFDB:E7FCE2	0.647	0.783	8.667E-64	810	0.361	0.441	E7FCE2.pdb.gz	E7FCE2_DANRE Chloride channel 2c OS=Danio rerio OX=7955 GN=im:6903943 PE=2 SV=1
6	PDB:6qvcA	0.577	0.935	9.105E-61	599	0.604	0.997	6qvcA.pdb.gz
7	AFDB:Q9BMK9	0.643	0.635	5.721E-56	1001	0.353	0.349	Q9BMK9.pdb.gz	CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans OX=6239 GN=clh-3 PE=1 SV=1
8	AFDB:P51802	0.578	0.818	2.572E-48	687	0.276	0.397	P51802.pdb.gz	CLCKB_RAT Chloride channel protein ClC-Kb OS=Rattus norvegicus OX=10116 GN=Clcnkb PE=1 SV=1
9	AFDB:Q06393	0.578	0.816	1.683E-46	687	0.278	0.400	Q06393.pdb.gz	CLCKA_RAT Chloride channel protein ClC-Ka OS=Rattus norvegicus OX=10116 GN=Clcnka PE=1 SV=3
10	AFDB:F1QAS1	0.574	0.807	4.925E-41	693	0.229	0.326	F1QAS1.pdb.gz
11	AFDB:P51798	0.533	0.648	2.233E-27	805	0.185	0.227	P51798.pdb.gz	CLCN7_HUMAN H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens OX=9606 GN=CLCN7 PE=1 SV=2
12	PDB:7jm7A	0.538	0.763	6.806E-25	683	0.170	0.246	7jm7A.pdb.gz	Cryo-EM structure of the lysosomal chloride-proton exchanger CLC-7 in complex with OSTM1.
13	PDB:1kpkA	0.378	0.794	5.127E-14	450	0.107	0.236	1kpkA.pdb.gz
14	PDB:6cozA	0.155	0.871	2.948E-13	160	0.162	1.000	6cozA.pdb.gz
15	PDB:6s4mA	0.095	0.170	7.977E-3	426	0.071	0.164	6s4mA.pdb.gz
16	PDB:7c76B	0.107	0.173	2.039E-2	483	0.056	0.114	7c76B.pdb.gz
17	PDB:7oixB	0.107	0.174	4.996E-2	451	0.062	0.135	7oixB.pdb.gz	Structural insights into the lysophospholipid brain uptake mechanism and its inhibition by syncytin-2.
18	PDB:5oxpA	0.121	0.204	7.335E-2	462	0.066	0.141	5oxpA.pdb.gz	Multispecific Substrate Recognition in a Proton-Dependent Oligopeptide Transporter.
19	PDB:2gfpA	0.083	0.153	8.336E-2	375	0.072	0.189	2gfpA.pdb.gz
20	PDB:7sptA	0.101	0.172	8.700E-2	470	0.068	0.143	7sptA.pdb.gz	Molecular basis for inhibiting human glucose transporters by exofacial inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A098DN12	0.0	863	898	0.459	0.504	A0A098DN12_DANRE Chloride channel protein 2 OS=Danio rerio OX=7955 GN=clcn2b PE=2 SV=1
2	E7FCE2	0.0	667	810	0.369	0.451	E7FCE2_DANRE Chloride channel 2c OS=Danio rerio OX=7955 GN=im:6903943 PE=2 SV=1
3	F1Q5F4	0.0	866	979	0.483	0.487	F1Q5F4_DANRE Chloride channel protein 2 OS=Danio rerio OX=7955 GN=clcn2a PE=2 SV=3
4	O54822	0.0	861	887	0.479	0.533	O54822_RAT Chloride channel protein 2 OS=Rattus norvegicus OX=10116 GN=ClC-2 PE=1 SV=1
5	P35523	0.0	2032	988	1.000	1.000	CLCN1_HUMAN Chloride channel protein 1 OS=Homo sapiens OX=9606 GN=CLCN1 PE=1 SV=3
6	P35524	0.0	1720	994	0.883	0.877	CLCN1_RAT Chloride channel protein 1 OS=Rattus norvegicus OX=10116 GN=Clcn1 PE=1 SV=1
7	P35525	0.0	851	907	0.468	0.509	CLCN2_RAT Chloride channel protein 2 OS=Rattus norvegicus OX=10116 GN=Clcn2 PE=1 SV=1
8	P51788	0.0	844	898	0.468	0.514	CLCN2_HUMAN Chloride channel protein 2 OS=Homo sapiens OX=9606 GN=CLCN2 PE=1 SV=2
9	Q64347	0.0	1711	994	0.880	0.874	CLCN1_MOUSE Chloride channel protein 1 OS=Mus musculus OX=10090 GN=Clcn1 PE=1 SV=3
10	Q9BMK9	0.0	558	1001	0.363	0.359	CLH3_CAEEL Chloride channel protein clh-3 OS=Caenorhabditis elegans OX=6239 GN=clh-3 PE=1 SV=1
11	Q9R0A1	0.0	848	908	0.465	0.506	CLCN2_MOUSE Chloride channel protein 2 OS=Mus musculus OX=10090 GN=Clcn2 PE=1 SV=2
12	Q9VGH7	0.0	595	1193	0.313	0.259	CLCN2_DROME Chloride channel protein 2 OS=Drosophila melanogaster OX=7227 GN=ClC-a PE=2 SV=3
13	Q9W701	1.61e-169	513	689	0.262	0.376	CLCKB_XENLA Chloride channel protein ClC-Kb OS=Xenopus laevis OX=8355 GN=clcnkb PE=1 SV=1
14	P51800	4.97e-145	450	687	0.256	0.368	CLCKA_HUMAN Chloride channel protein ClC-Ka OS=Homo sapiens OX=9606 GN=CLCNKA PE=1 SV=1
15	Q9WUB7	7.68e-145	449	687	0.251	0.361	CLCKA_MOUSE Chloride channel protein ClC-Ka OS=Mus musculus OX=10090 GN=Clcnka PE=1 SV=2
16	Q06393	8.49e-143	444	687	0.249	0.358	CLCKA_RAT Chloride channel protein ClC-Ka OS=Rattus norvegicus OX=10116 GN=Clcnka PE=1 SV=3
17	P51801	2.03e-141	440	687	0.253	0.364	CLCKB_HUMAN Chloride channel protein ClC-Kb OS=Homo sapiens OX=9606 GN=CLCNKB PE=1 SV=3
18	P51802	2.59e-137	429	687	0.246	0.354	CLCKB_RAT Chloride channel protein ClC-Kb OS=Rattus norvegicus OX=10116 GN=Clcnkb PE=1 SV=1
19	Q9WUB6	2.62e-137	429	687	0.245	0.352	CLCKB_MOUSE Chloride channel protein ClC-Kb OS=Mus musculus OX=10090 GN=Clcnkb PE=1 SV=2
20	Q7T329	9.99e-106	346	693	0.216	0.307	Q7T329_DANRE Chloride channel protein ClC-Ka OS=Danio rerio OX=7955 GN=zgc:64141 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00571 CBS	5.8e+02	12.3	CBS domain
2	PF00654 Voltage_CLC	5.6e-80	280.8	Voltage gated chloride channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339867

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000396320	0.841	Sodium channel protein type 4 subunit alpha
2	9606.ENSP00000360312	0.798	Barttin
3	9606.ENSP00000003084	0.778	Cystic fibrosis transmembrane conductance regulator
4	9606.ENSP00000282486	0.767	Muscleblind-like protein 1
5	9606.ENSP00000332413	0.764	Bestrophin-3
6	9606.ENSP00000399709	0.734	Bestrophin-1
7	9606.ENSP00000347454	0.724	Anoctamin-1
8	9606.ENSP00000361281	0.717	Bestrophin-4
9	9606.ENSP00000345997	0.710	Myotonin-protein kinase
10	9606.ENSP00000410769	0.709	Cellular nucleic acid-binding protein
11	9606.ENSP00000448310	0.709	Bestrophin-2
12	9606.ENSP00000271751	0.691	Potassium voltage-gated channel subfamily H member 1
13	9606.ENSP00000348453	0.690	Anoctamin-2
14	9606.ENSP00000355192	0.687	Voltage-dependent L-type calcium channel subunit alpha-1S
15	9606.ENSP00000373298	0.687	Acetylcholinesterase collagenic tail peptide
16	9606.ENSP00000435926	0.681	CUGBP Elav-like family member 1
17	9606.ENSP00000231948	0.680	Protein cereblon
18	9606.ENSP00000349595	0.679	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
19	9606.ENSP00000267287	0.666	Muscleblind-like protein 2
20	9606.ENSP00000321427	0.658	Potassium voltage-gated channel subfamily H member 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005247	1.000	voltage-gated chloride channel activity
GO:0005515	0.998	protein binding
GO:0042802	0.651	identical protein binding
GO:0046983	0.537	protein dimerization activity
GO:0042803	0.518	protein homodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0015698	0.987	inorganic anion transport
GO:0006820	0.987	monoatomic anion transport
GO:0009987	0.962	cellular process
GO:0006821	0.957	chloride transport
GO:0065007	0.863	biological regulation
GO:0032501	0.717	multicellular organismal process
GO:0003008	0.569	system process
GO:0034220	0.506	monoatomic ion transmembrane transport
GO:0050789	0.384	regulation of biological process
GO:0050794	0.340	regulation of cellular process
GO:0007154	0.306	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29823	1.000	chloride(in) = chloride(out)

[back to server]