StarFunc result for job id P35527

User Input

>input (623 residues)
MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSSSGYGGGSSRV
CGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSG
GGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANND
LENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFR
IKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLT
GQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSG
QEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLE
AQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRGG
SGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGG
GHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSY
GGGEEASGSGGGYGGGSGKSSHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35527	1.000	1.000	1.020E-66	623	1.000	1.000	P35527.pdb.gz	K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3
2	AFDB:Q8CIS9	0.442	0.445	1.763E-34	618	0.671	0.676	Q8CIS9.pdb.gz	K1C9_RAT Keratin, type I cytoskeletal 9 OS=Rattus norvegicus OX=10116 GN=Krt9 PE=1 SV=1
3	AFDB:Q6RHW0	0.254	0.216	2.472E-33	743	0.700	0.587	Q6RHW0.pdb.gz	K1C9_MOUSE Keratin, type I cytoskeletal 9 OS=Mus musculus OX=10090 GN=Krt9 PE=1 SV=3
4	AFDB:Q6IFV1	0.279	0.347	3.976E-24	485	0.393	0.505	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
5	AFDB:P08779	0.295	0.373	6.553E-24	473	0.392	0.516	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
6	AFDB:P02533	0.283	0.358	1.912E-23	472	0.387	0.511	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
7	AFDB:Q61414	0.298	0.386	5.192E-23	452	0.361	0.498	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
8	AFDB:Q6IFV4	0.287	0.392	9.870E-23	438	0.366	0.521	Q6IFV4.pdb.gz	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
9	AFDB:Q9Z2K1	0.271	0.345	1.223E-22	469	0.366	0.486	Q9Z2K1.pdb.gz	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
10	AFDB:Q6PVZ1	0.333	0.434	1.313E-22	467	0.364	0.486	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
11	PDB:7ungb	0.176	0.285	3.355	334	0.085	0.159	7ungb.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35527	0.0	1157	623	1.000	1.000	K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3
2	Q6RHW0	5.27e-167	496	743	0.368	0.308	K1C9_MOUSE Keratin, type I cytoskeletal 9 OS=Mus musculus OX=10090 GN=Krt9 PE=1 SV=3
3	P13646	4.10e-125	379	458	0.287	0.391	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
4	A1A4E9	7.59e-125	378	458	0.286	0.389	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
5	K7ERE3	3.89e-124	375	415	0.287	0.431	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
6	P08730	9.23e-123	372	437	0.284	0.405	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
7	P02533	1.66e-121	370	472	0.291	0.383	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
8	Q6IFU8	2.59e-118	360	433	0.318	0.457	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
9	Q6IFV4	1.39e-117	359	438	0.331	0.470	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
10	P08779	2.16e-117	359	473	0.297	0.391	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
11	Q6IFV3	3.81e-117	358	447	0.274	0.383	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
12	Q6IFV1	3.89e-117	359	485	0.308	0.396	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
13	Q61414	7.40e-117	357	452	0.274	0.378	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
14	Q9QWL7	7.32e-116	354	433	0.313	0.450	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
15	P19001	2.37e-115	352	403	0.299	0.462	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
16	P19012	5.35e-115	353	456	0.292	0.399	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
17	Q61781	3.91e-114	352	484	0.311	0.401	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
18	Q6PVZ1	6.62e-114	350	467	0.276	0.368	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
19	Q63279	9.66e-113	345	403	0.289	0.447	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
20	Q9Z2K1	1.71e-112	347	469	0.281	0.373	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04513 Baculo_PEP_C	46	15.5	Baculovirus polyhedron envelope protein, PEP, C terminus
2	PF05667 CCDC22	9.7e+02	9.9	Coiled-coil domain-containing protein 22
3	PF19220 Crescentin	1.9e+02	12.5	Crescentin protein
4	PF14362 DUF4407	32	15.3	Domain of unknown function (DUF4407)
5	PF00038 Filament	8.8e-101	349.2	Intermediate filament protein
6	PF02050 FliJ	1.1e+02	14.4	Flagellar FliJ protein
7	PF14282 FlxA	20	16.7	FlxA-like protein
8	PF01576 Myosin_tail_1	3.9e+02	10.2	Myosin tail
9	PF12325 TMF_TATA_bd	16	17.0	TATA element modulatory factor 1 TATA binding
10	PF07926 TPR_MLP1_2	1.1e+02	14.3	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000246662

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.666	Cadherin-1
2	9606.ENSP00000261880	0.642	Alpha- and gamma-adaptin-binding protein p34
3	9606.ENSP00000363985	0.623	Myotubularin-related protein 8
4	9606.ENSP00000311505	0.589	IQ calmodulin-binding motif-containing protein 1
5	9606.ENSP00000221086	0.580	Myotubularin-related protein 9
6	9606.ENSP00000251645	0.559	Keratin, type I cuticular Ha1
7	9606.ENSP00000251646	0.554	Keratin, type I cuticular Ha3-II
8	9606.ENSP00000007735	0.550	Keratin, type I cuticular Ha3-I
9	9606.ENSP00000377570	0.547	Keratin, type I cuticular Ha4
10	9606.ENSP00000227266	0.537	Dipeptidyl peptidase 1
11	9606.ENSP00000225899	0.533	Keratin, type I cuticular Ha2
12	9606.ENSP00000329165	0.529	Keratin, type I cuticular Ha6
13	9606.ENSP00000246646	0.525	Keratin, type I cuticular Ha8
14	9606.ENSP00000334798	0.525	Keratin, type I cytoskeletal 26
15	9606.ENSP00000305263	0.520	Keratin, type I cytoskeletal 28
16	9606.ENSP00000225550	0.514	Keratin, type I cuticular Ha7
17	9606.ENSP00000310573	0.514	Keratin, type I cytoskeletal 25
18	9606.ENSP00000377558	0.511	Keratin, type I cuticular Ha5
19	9606.ENSP00000366984	0.510	Keratin, type I cytoskeletal 40
20	9606.ENSP00000347823	0.502	Keratin, type I cytoskeletal 39

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005200	0.998	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032502	0.997	developmental process
GO:0009987	0.987	cellular process
GO:0048856	0.982	anatomical structure development
GO:0043588	0.951	skin development
GO:0008544	0.919	epidermis development
GO:0071840	0.863	cellular component organization or biogenesis
GO:0016043	0.846	cellular component organization
GO:0045104	0.685	intermediate filament cytoskeleton organization
GO:0045109	0.656	intermediate filament organization
GO:0032501	0.528	multicellular organismal process
GO:0065007	0.384	biological regulation
GO:0050789	0.322	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0005856	0.989	cytoskeleton
GO:0043227	0.987	membrane-bounded organelle
GO:0005829	0.985	cytosol
GO:0099512	0.981	supramolecular fiber
GO:0005576	0.978	extracellular region
GO:0005634	0.978	nucleus
GO:0005882	0.964	intermediate filament
GO:0016020	0.957	membrane
GO:0071944	0.955	cell periphery
GO:0005615	0.935	extracellular space
GO:0070062	0.920	extracellular exosome
GO:0005886	0.768	plasma membrane
GO:0045095	0.603	keratin filament
GO:0048471	0.367	perinuclear region of cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]