StarFunc result for job id P35548

User Input

>input (267 residues)
MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPK
EASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG
RYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLN
LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASY
PFHRPVLPIPPVGLYATPVGYGMYHLS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35548	0.999	0.999	5.749E-39	267	1.000	1.000	P35548.pdb.gz	MSX2_HUMAN Homeobox protein MSX-2 OS=Homo sapiens OX=9606 GN=MSX2 PE=1 SV=3
2	AFDB:Q01703	0.473	0.465	1.584E-19	273	0.513	0.502	Q01703.pdb.gz	MSXC_DANRE Homeobox protein MSH-C OS=Danio rerio OX=7955 GN=msxc PE=2 SV=1
3	AFDB:Q03356	0.430	0.446	6.938E-19	257	0.491	0.510	Q03356.pdb.gz	MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio OX=7955 GN=msxb PE=2 SV=3
4	AFDB:Q09604	0.295	0.348	5.786E-11	225	0.315	0.373	Q09604.pdb.gz	VAB15_CAEEL Homeobox protein vab-15 OS=Caenorhabditis elegans OX=6239 GN=vab-15 PE=2 SV=1
5	AFDB:P42581	0.295	0.225	4.862E-9	356	0.337	0.253	P42581.pdb.gz	HMX3_MOUSE Homeobox protein HMX3 OS=Mus musculus OX=10090 GN=Hmx3 PE=1 SV=3
6	AFDB:P50575	0.246	0.228	7.148E-9	289	0.281	0.260	P50575.pdb.gz	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1
7	AFDB:Q5TIS6	0.286	0.312	7.148E-9	240	0.255	0.283	Q5TIS6.pdb.gz	NOTO_MOUSE Homeobox protein notochord OS=Mus musculus OX=10090 GN=Noto PE=1 SV=1
8	AFDB:P18111	0.292	0.291	1.051E-8	268	0.258	0.257	P18111.pdb.gz	CDX1_MOUSE Homeobox protein CDX-1 OS=Mus musculus OX=10090 GN=Cdx1 PE=1 SV=2
9	AFDB:A8MTQ0	0.312	0.329	1.449E-8	251	0.225	0.239	A8MTQ0.pdb.gz	NOTO_HUMAN Homeobox protein notochord OS=Homo sapiens OX=9606 GN=NOTO PE=1 SV=2
10	AFDB:A0A2R8Q2A2	0.272	0.258	1.545E-8	282	0.277	0.262	A0A2R8Q2A2.pdb.gz
11	PDB:4egcA	0.190	0.094	9.020E-3	539	0.056	0.028	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.196	0.637	4.492E-2	73	0.056	0.205	2hi3A.pdb.gz
13	PDB:7fbyA	0.151	0.243	2.098E-1	153	0.045	0.078	7fbyA.pdb.gz	Crystal Structure of PH0140 from Pyrococcus horikosii OT3
14	PDB:6dv9F	0.114	0.165	1.045	174	0.064	0.098	6dv9F.pdb.gz	Structural basis of ECF-sigma-factor-dependent transcription initiation.
15	PDB:7dcoL	0.140	0.090	1.114	435	0.101	0.062	7dcoL.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
16	PDB:5aj0BZ	0.155	0.417	1.638	86	0.030	0.093	5aj0BZ.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:5nr5A	0.139	0.306	1.638	113	0.052	0.124	5nr5A.pdb.gz
18	PDB:2cjjA	0.194	0.711	2.118	63	0.034	0.143	2cjjA.pdb.gz
19	PDB:7awtE	0.102	0.160	2.118	156	0.019	0.032	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
20	PDB:4lgwA	0.108	0.118	2.259	238	0.034	0.038	4lgwA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35548	0.0	535	267	1.000	1.000	MSX2_HUMAN Homeobox protein MSX-2 OS=Homo sapiens OX=9606 GN=MSX2 PE=1 SV=3
2	Q03358	6.67e-173	479	267	0.925	0.925	MSX2_MOUSE Homeobox protein MSX-2 OS=Mus musculus OX=10090 GN=Msx2 PE=1 SV=2
3	P52953	8.32e-96	279	139	0.509	0.978	MSX2_RAT Homeobox protein MSX-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Msx2 PE=3 SV=1
4	D6RIS4	5.91e-84	249	134	0.476	0.948	D6RIS4_HUMAN Msh homeobox 2 OS=Homo sapiens OX=9606 GN=MSX2 PE=1 SV=1
5	P28360	3.41e-83	253	303	0.581	0.512	MSX1_HUMAN Homeobox protein MSX-1 OS=Homo sapiens OX=9606 GN=MSX1 PE=1 SV=3
6	Q9QUG0	6.24e-83	252	297	0.584	0.525	Q9QUG0_RAT Msx-1 protein OS=Rattus norvegicus OX=10116 GN=Msx1 PE=2 SV=1
7	P13297	4.74e-82	250	303	0.577	0.508	MSX1_MOUSE Homeobox protein MSX-1 OS=Mus musculus OX=10090 GN=Msx1 PE=1 SV=4
8	P28361	3.46e-70	218	249	0.408	0.438	MSX1_CHICK Homeobox protein MSX-1 OS=Gallus gallus OX=9031 GN=MSX1 PE=2 SV=1
9	Q01703	1.34e-69	217	273	0.539	0.527	MSXC_DANRE Homeobox protein MSH-C OS=Danio rerio OX=7955 GN=msxc PE=2 SV=1
10	Q90455	3.23e-69	215	233	0.494	0.567	Q90455_DANRE Homeobox protein MSX-1 OS=Danio rerio OX=7955 GN=msxE PE=2 SV=1
11	Q03356	2.45e-68	214	257	0.479	0.498	MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio OX=7955 GN=msxb PE=2 SV=3
12	P70354	1.56e-58	187	204	0.390	0.510	MSX3_MOUSE Homeobox protein MSX-3 OS=Mus musculus OX=10090 GN=Msx3 PE=1 SV=1
13	Q03372	2.22e-41	150	515	0.277	0.144	HMSH_DROME Muscle segmentation homeobox OS=Drosophila melanogaster OX=7227 GN=Dr PE=1 SV=2
14	Q09604	1.27e-38	136	225	0.236	0.280	VAB15_CAEEL Homeobox protein vab-15 OS=Caenorhabditis elegans OX=6239 GN=vab-15 PE=2 SV=1
15	G5EE18	6.78e-21	89.7	201	0.184	0.244	CEH28_CAEEL Homeobox protein ceh-28 OS=Caenorhabditis elegans OX=6239 GN=ceh-28 PE=2 SV=1
16	A6NCS4	2.99e-20	90.1	301	0.157	0.140	NKX26_HUMAN Homeobox protein Nkx-2.6 OS=Homo sapiens OX=9606 GN=NKX2-6 PE=1 SV=1
17	P56178	6.72e-20	89.0	289	0.243	0.225	DLX5_HUMAN Homeobox protein DLX-5 OS=Homo sapiens OX=9606 GN=DLX5 PE=1 SV=2
18	P70396	1.54e-19	87.8	289	0.247	0.228	DLX5_MOUSE Homeobox protein DLX-5 OS=Mus musculus OX=10090 GN=Dlx5 PE=1 SV=1
19	O13005	1.90e-19	85.5	193	0.184	0.254	O13005_CHICK Nkx2-8 protein OS=Gallus gallus OX=9031 GN=Nkx2-8 PE=2 SV=1
20	P50575	1.08e-18	85.5	289	0.243	0.225	DLX5_RAT Homeobox protein DLX-5 OS=Rattus norvegicus OX=10116 GN=Dlx5 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05920 Homeobox_KN	4e+02	12.3	Homeobox KN domain
2	PF00046 Homeodomain	3.8e-18	76.4	Homeodomain
3	PF10254 Pacs-1	3.2e+02	11.7	PACS-1 cytosolic sorting protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000239243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360493	0.992	Runt-related transcription factor 2
2	9606.ENSP00000427514	0.891	CCAAT/enhancer-binding protein alpha
3	9606.ENSP00000372170	0.860	Homeobox protein MSX-1
4	9606.ENSP00000242261	0.842	Twist-related protein 1
5	9606.ENSP00000222598	0.810	Homeobox protein DLX-5
6	9606.ENSP00000245451	0.810	Bone morphogenetic protein 4
7	9606.ENSP00000364847	0.794	Melanoma-associated antigen D1
8	9606.ENSP00000368104	0.786	Bone morphogenetic protein 2
9	9606.ENSP00000371875	0.757	Homeobox protein Nkx-3.2
10	9606.ENSP00000257566	0.747	T-box transcription factor TBX3
11	9606.ENSP00000240328	0.720	T-box transcription factor TBX2
12	9606.ENSP00000428480	0.704	Homeobox protein DLX-6
13	9606.ENSP00000245479	0.699	Transcription factor SOX-9
14	9606.ENSP00000379140	0.698	Stromal cell-derived factor 1
15	9606.ENSP00000443827	0.698	Transcription factor Sp7
16	9606.ENSP00000357255	0.694	Osteocalcin
17	9606.ENSP00000361664	0.686	Transcription factor HIVEP3
18	9606.ENSP00000354394	0.680	Signal transducer and activator of transcription 1-alpha/beta
19	9606.ENSP00000395389	0.667	Lysophosphatidic acid receptor 3
20	9606.ENSP00000219548	0.661	E3 ubiquitin-protein ligase CHIP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	1.000	sequence-specific double-stranded DNA binding
GO:0003700	0.978	DNA-binding transcription factor activity
GO:0001067	0.888	transcription regulatory region nucleic acid binding
GO:0000976	0.884	transcription cis-regulatory region binding
GO:0000981	0.877	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.448	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0032502	0.995	developmental process
GO:0048731	0.988	system development
GO:0009987	0.978	cellular process
GO:0009888	0.950	tissue development
GO:0048513	0.936	animal organ development
GO:0019222	0.923	regulation of metabolic process
GO:0050896	0.915	response to stimulus
GO:0048523	0.912	negative regulation of cellular process
GO:0010468	0.912	regulation of gene expression
GO:0048522	0.888	positive regulation of cellular process
GO:0051171	0.886	regulation of nitrogen compound metabolic process
GO:0006355	0.884	regulation of DNA-templated transcription
GO:0009653	0.865	anatomical structure morphogenesis
GO:0001501	0.846	skeletal system development
GO:0006357	0.822	regulation of transcription by RNA polymerase II
GO:0051716	0.784	cellular response to stimulus
GO:0048598	0.762	embryonic morphogenesis
GO:0009887	0.709	animal organ morphogenesis
GO:0009893	0.702	positive regulation of metabolic process
GO:0010604	0.694	positive regulation of macromolecule metabolic process
GO:0023052	0.679	signaling
GO:0007154	0.678	cell communication
GO:0010605	0.615	negative regulation of macromolecule metabolic process
GO:0051173	0.598	positive regulation of nitrogen compound metabolic process
GO:0031325	0.591	positive regulation of cellular metabolic process
GO:0031327	0.585	negative regulation of cellular biosynthetic process
GO:0045892	0.580	negative regulation of DNA-templated transcription
GO:0007165	0.566	signal transduction
GO:0048583	0.555	regulation of response to stimulus
GO:0010646	0.539	regulation of cell communication
GO:0023051	0.535	regulation of signaling
GO:0050793	0.534	regulation of developmental process
GO:0048705	0.514	skeletal system morphogenesis
GO:0030154	0.506	cell differentiation
GO:0051254	0.476	positive regulation of RNA metabolic process
GO:0000122	0.473	negative regulation of transcription by RNA polymerase II
GO:0051239	0.459	regulation of multicellular organismal process
GO:0009966	0.457	regulation of signal transduction
GO:0045893	0.452	positive regulation of DNA-templated transcription
GO:0045944	0.419	positive regulation of transcription by RNA polymerase II
GO:0060348	0.394	bone development
GO:0007166	0.341	cell surface receptor signaling pathway
GO:1904888	0.340	cranial skeletal system development
GO:0045595	0.318	regulation of cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0032991	0.601	protein-containing complex
GO:0005737	0.583	cytoplasm
GO:0005829	0.464	cytosol
GO:0016607	0.341	nuclear speck

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]