StarFunc result for job id P35555

User Input

>input (1400 residues)
MRRGRLLEIALGFTVLLASYTSHGADANLEAGNVKETRASRAKRRGGGGHDALKGPNVCG
SRYNAYCCPGWKTLPGGNQCIVPICRHSCGDGFCSRPNMCTCPSGQIAPSCGSRSIQHCN
IRCMNGGSCSDDHCLCQKGYIGTHCGQPVCESGCLNGGRCVAPNRCACTYGFTGPQCERD
YRTGPCFTVISNQMCQGQLSGIVCTKTLCCATVGRAWGHPCEMCPAQPHPCRRGFIPNIR
TGACQDVDECQAIPGLCQGGNCINTVGSFECKCPAGHKLNEVSQKCEDIDECSTIPGICE
GGECTNTVSSYFCKCPPGFYTSPDGTRCIDVRPGYCYTALTNGRCSNQLPQSITKMQCCC
DAGRCWSPGVTVAPEMCPIRATEDFNKLCSVPMVIPGRPEYPPPPLGPIPPVLPVPPGFP
PGPQIPVPRPPVEYLYPSREPPRVLPVNVTDYCQLVRYLCQNGRCIPTPGSYRCECNKGF
QLDLRGECIDVDECEKNPCAGGECINNQGSYTCQCRAGYQSTLTRTECRDIDECLQNGRI
CNNGRCINTDGSFHCVCNAGFHVTRDGKNCEDMDECSIRNMCLNGMCINEDGSFKCICKP
GFQLASDGRYCKDINECETPGICMNGRCVNTDGSYRCECFPGLAVGLDGRVCVDTHMRST
CYGGYKRGQCIKPLFGAVTKSECCCASTEYAFGEPCQPCPAQNSAEYQALCSSGPGMTSA
GSDINECALDPDICPNGICENLRGTYKCICNSGYEVDSTGKNCVDINECVLNSLLCDNGQ
CRNTPGSFVCTCPKGFIYKPDLKTCEDIDECESSPCINGVCKNSPGSFICECSSESTLDP
TKTICIETIKGTCWQTVIDGRCEININGATLKSQCCSSLGAAWGSPCTLCQVDPICGKGY
SRIKGTQCEDIDECEVFPGVCKNGLCVNTRGSFKCQCPSGMTLDATGRICLDIRLETCFL
RYEDEECTLPIAGRHRMDACCCSVGAAWGTEECEECPMRNTPEYEELCPRGPGFATKEIT
NGKPFFKDINECKMIPSLCTHGKCRNTIGSFKCRCDSGFALDSEERNCTDIDECRISPDL
CGRGQCVNTPGDFECKCDEGYESGFMMMKNCMDIDECQRDPLLCRGGVCHNTEGSYRCEC
PPGHQLSPNISACIDINECELSAHLCPNGRCVNLIGKYQCACNPGYHSTPDRLFCVDIDE
CSIMNGGCETFCTNSEGSYECSCQPGFALMPDQRSCTDIDECEDNPNICDGGQCTNIPGE
YRCLCYDGFMASEDMKTCVDVNECDLNPNICLSGTCENTKGSFICHCDMGYSGKKGKTGC
TDINECEIGAHNCGKHAVCTNTAGSFKCSCSPGWIGDGIKCTDLDECSNGTHMCSQHADC
KNTMGSYRCLCKEGYTGDGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8N2S1	0.105	0.092	1.685E-71	1624	0.294	0.254	Q8N2S1.pdb.gz	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
2	AFDB:Q8K4G1	0.109	0.092	5.790E-71	1666	0.276	0.232	Q8K4G1.pdb.gz	LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2
3	AFDB:E7FG71	0.094	0.475	3.664E-33	252	0.126	0.698	E7FG71.pdb.gz
4	AFDB:O75095	0.115	0.109	9.351E-28	1541	0.229	0.208	O75095.pdb.gz	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
5	AFDB:O00339	0.083	0.105	1.704E-25	956	0.097	0.142	O00339.pdb.gz	MATN2_HUMAN Matrilin-2 OS=Homo sapiens OX=9606 GN=MATN2 PE=1 SV=4
6	AFDB:A0A1F4	0.080	0.058	4.308E-11	2176	0.071	0.045	A0A1F4.pdb.gz	EYS_DROME Protein eyes shut OS=Drosophila melanogaster OX=7227 GN=eys PE=1 SV=1
7	PDB:7q3nU	0.062	0.204	1.061E-7	292	0.034	0.164	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
8	AFDB:F1R8J2	0.053	0.041	9.825E-7	2014	0.097	0.068	F1R8J2.pdb.gz
9	AFDB:E9Q7X6	0.055	0.058	4.415E-6	1337	0.087	0.091	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
10	AFDB:Q9ULI3	0.058	0.058	1.291E-5	1381	0.096	0.097	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
11	PDB:7nycC	0.039	0.060	5.106E-4	809	0.049	0.085	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
12	AFDB:P55066	0.064	0.070	5.237E-4	1268	0.087	0.096	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
13	PDB:4e0sB	0.033	0.037	2.708E-2	898	0.042	0.066	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
14	PDB:7n9qA	0.058	0.044	3.737E-2	2315	0.051	0.031	7n9qA.pdb.gz
15	PDB:3b4vD	0.049	0.190	3.943E-2	213	0.026	0.174	3b4vD.pdb.gz
16	PDB:3t5oA	0.041	0.055	1.508E-1	871	0.048	0.077	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
17	PDB:4bxsA	0.028	0.154	2.872E-1	248	0.010	0.056	4bxsA.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
18	PDB:5es4B	0.057	0.094	2.872E-1	674	0.034	0.070	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
19	PDB:7n9sA	0.032	0.026	3.197E-1	2365	0.052	0.031	7n9sA.pdb.gz
20	PDB:7nxdB	0.039	0.070	3.559E-1	690	0.021	0.042	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KQ62	0.0	1927	2868	0.679	0.332	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
2	A0A8I6A897	0.0	2103	2813	0.809	0.402	A0A8I6A897_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
3	A0A8I6G7Y9	0.0	2480	2861	0.919	0.449	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
4	B6CS38	0.0	1927	2868	0.679	0.332	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1
5	G3V9M6	0.0	2637	2872	0.959	0.468	G3V9M6_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
6	P35555	0.0	2812	2871	1.000	0.488	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
7	P35556	0.0	1963	2912	0.692	0.333	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
8	P98133	0.0	2754	2871	0.976	0.476	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2
9	Q61554	0.0	2621	2873	0.956	0.466	FBN1_MOUSE Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2
10	Q61555	0.0	1961	2907	0.689	0.332	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
11	Q9WUH8	0.0	2631	2872	0.957	0.467	Q9WUH8_RAT Fibrillin-1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=2 SV=1
12	A7YY58	5.52e-107	372	1338	0.264	0.276	A7YY58_BOVIN LTBP1 protein OS=Bos taurus OX=9913 GN=LTBP1 PE=2 SV=1
13	Q14766	3.92e-105	371	1721	0.255	0.207	LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4
14	Q8CG19	1.68e-104	369	1712	0.250	0.204	LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus OX=10090 GN=Ltbp1 PE=1 SV=2
15	O08999	7.17e-103	365	1813	0.279	0.215	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2
16	Q14767	5.18e-99	353	1821	0.227	0.175	LTBP2_HUMAN Latent-transforming growth factor beta-binding protein 2 OS=Homo sapiens OX=9606 GN=LTBP2 PE=1 SV=3
17	Q00918	1.11e-98	352	1712	0.249	0.203	LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ltbp1 PE=1 SV=1
18	B7ZLY3	3.27e-96	341	1353	0.248	0.256	B7ZLY3_HUMAN LTBP1 protein OS=Homo sapiens OX=9606 GN=LTBP1 PE=2 SV=1
19	Q8N2S1	6.04e-96	343	1624	0.201	0.173	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2
20	Q8K4G1	1.85e-89	323	1666	0.238	0.200	LTBP4_MOUSE Latent-transforming growth factor beta-binding protein 4 OS=Mus musculus OX=10090 GN=Ltbp4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.4e-109	368.7	Complement Clr-like EGF-like
2	PF00008 EGF	6e-52	184.8	EGF-like domain
3	PF12947 EGF_3	7.9e-53	187.6	EGF domain
4	PF07645 EGF_CA	1.2e-147	491.2	Calcium-binding EGF domain
5	PF18193 Fibrillin_U_N	3.2e-18	76.7	Fibrillin 1 unique N-terminal domain
6	PF14670 FXa_inhibition	8.3e-44	158.9	Coagulation Factor Xa inhibitory site
7	PF12661 hEGF	4.7e-45	162.0	Human growth factor-like EGF
8	PF06247 Plasmod_Pvs28	1.8e-09	49.0	Pvs28 EGF domain
9	PF00683 TB	4e-52	185.1	TB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000325527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351807	0.995	Elastin
2	9606.ENSP00000364685	0.995	Microfibrillar-associated protein 2
3	9606.ENSP00000352455	0.981	Microfibrillar-associated protein 5
4	9606.ENSP00000304408	0.963	Collagen alpha-1(III) chain
5	9606.ENSP00000346839	0.961	Fibronectin type III domain containing
6	9606.ENSP00000265077	0.959	Versican core protein
7	9606.ENSP00000346478	0.953	ADAMTS-like protein 2
8	9606.ENSP00000424571	0.949	Fibrillin-2
9	9606.ENSP00000483552	0.945	Furin
10	9606.ENSP00000379350	0.941	Integrin beta-1
11	9606.ENSP00000283249	0.936	Integrin beta-6
12	9606.ENSP00000293379	0.933	Integrin alpha-5
13	9606.ENSP00000297268	0.930	Collagen alpha-2(I) chain
14	9606.ENSP00000452786	0.929	Integrin beta-3
15	9606.ENSP00000261023	0.927	Integrin alpha-V
16	9606.ENSP00000270328	0.923	A disintegrin and metalloproteinase with thrombospondin motifs 10
17	9606.ENSP00000379204	0.911	Bone morphogenetic protein 7
18	9606.ENSP00000052754	0.903	Decorin
19	9606.ENSP00000470498	0.902	Fibrillin-3
20	9606.ENSP00000231004	0.900	Protein-lysine 6-oxidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	0.999	hormone activity
GO:0046872	0.906	metal ion binding
GO:0019955	0.373	cytokine binding
GO:0005509	0.336	calcium ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0072001	0.988	renal system development
GO:0050896	0.986	response to stimulus
GO:0071559	0.984	response to transforming growth factor beta
GO:0009987	0.961	cellular process
GO:0001656	0.961	metanephros development
GO:0071560	0.947	cellular response to transforming growth factor beta stimulus
GO:0051716	0.941	cellular response to stimulus
GO:1901652	0.935	response to peptide
GO:1901701	0.913	cellular response to oxygen-containing compound
GO:1901699	0.895	cellular response to nitrogen compound
GO:0071375	0.886	cellular response to peptide hormone stimulus
GO:0050794	0.823	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0062023	0.998	collagen-containing extracellular matrix
GO:0005615	0.571	extracellular space
GO:0099512	0.566	supramolecular fiber
GO:0001527	0.515	microfibril

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]