StarFunc result for job id P35556

User Input

>input (1400 residues)
MGRRRRLCLQLYFLWLGCVVLWAQGTAGQPQPPPPKPPRPQPPPQQVRSATAGSEGGFLA
PEYREEGAAVASRVRRRGQQDVLRGPNVCGSRFHSYCCPGWKTLPGGNQCIVPICRNSCG
DGFCSRPNMCTCSSGQISSTCGSKSIQQCSVRCMNGGTCADDHCQCQKGYIGTYCGQPVC
ENGCQNGGRCIGPNRCACVYGFTGPQCERDYRTGPCFTQVNNQMCQGQLTGIVCTKTLCC
ATIGRAWGHPCEMCPAQPQPCRRGFIPNIRTGACQDVDECQAIPGICQGGNCINTVGSFE
CRCPAGHKQSETTQKCEDIDECSIIPGICETGECSNTVGSYFCVCPRGYVTSTDGSRCID
QRTGMCFSGLVNGRCAQELPGRMTKMQCCCEPGRCWGIGTIPEACPVRGSEEYRRLCMDG
LPMGGIPGSAGSRPGGTGGNGFAPSGNGNGYGPGGTGFIPIPGGNGFSPGVGGAGVGAGG
QGPIITGLTILNQTIDICKHHANLCLNGRCIPTVSSYRCECNMGYKQDANGDCIDVDECT
SNPCTNGDCVNTPGSYYCKCHAGFQRTPTKQACIDIDECIQNGVLCKNGRCVNTDGSFQC
ICNAGFELTTDGKNCVDHDECTTTNMCLNGMCINEDGSFKCICKPGFVLAPNGRYCTDVD
ECQTPGICMNGHCINSEGSFRCDCPPGLAVGMDGRVCVDTHMRSTCYGGIKKGVCVRPFP
GAVTKSECCCANPDYGFGEPCQPCPAKNSAEFHGLCSSGVGITVDGRDINECALDPDICA
NGICENLRGSYRCNCNSGYEPDASGRNCIDIDECLVNRLLCDNGLCRNTPGSYSCTCPPG
YVFRTETETCEDINECESNPCVNGACRNNLGSFNCECSPGSKLSSTGLICIDSLKGTCWL
NIQDSRCEVNINGATLKSECCATLGAAWGSPCERCELDTACPRGLARIKGVTCEDVNECE
VFPGVCPNGRCVNSKGSFHCECPEGLTLDGTGRVCLDIRMEQCYLKWDEDECIHPVPGKF
RMDACCCAVGAAWGTECEECPKPGTKEYETLCPRGAGFANRGDVLTGRPFYKDINECKAF
PGMCTYGKCRNTIGSFKCRCNSGFALDMEERNCTDIDECRISPDLCGSGICVNTPGSFEC
ECFEGYESGFMMMKNCMDIDECERNPLLCRGGTCVNTEGSFQCDCPLGHELSPSREDCVD
INECSLSDNLCRNGKCVNMIGTYQCSCNPGYQATPDRQGCTDIDECMIMNGGCDTQCTNS
EGSYECSCSEGYALMPDGRSCADIDECENNPDICDGGQCTNIPGEYRCLCYDGFMASMDM
KTCIDVNECDLNSNICMFGECENTKGSFICHCQLGYSVKKGTTGCTDVDECEIGAHNCDM
HASCLNIPGSFKCSCREGWI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7FG71	0.094	0.484	2.339E-34	252	0.137	0.762	E7FG71.pdb.gz
2	AFDB:O75095	0.103	0.096	1.115E-26	1541	0.209	0.190	O75095.pdb.gz	MEGF6_HUMAN Multiple epidermal growth factor-like domains protein 6 OS=Homo sapiens OX=9606 GN=MEGF6 PE=1 SV=4
3	PDB:7q3nU	0.054	0.196	1.628E-7	292	0.039	0.188	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
4	AFDB:Q9ULI3	0.061	0.061	2.781E-6	1381	0.098	0.099	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
5	AFDB:F1R8J2	0.073	0.056	3.647E-6	2014	0.097	0.068	F1R8J2.pdb.gz
6	AFDB:Q6R8J2	0.045	0.061	3.850E-6	977	0.100	0.143	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
7	AFDB:E9Q7X6	0.057	0.059	2.864E-5	1337	0.115	0.120	E9Q7X6.pdb.gz	HEG1_MOUSE Protein HEG homolog 1 OS=Mus musculus OX=10090 GN=Heg1 PE=1 SV=1
8	AFDB:P55066	0.061	0.066	5.356E-4	1268	0.079	0.087	P55066.pdb.gz	NCAN_MOUSE Neurocan core protein OS=Mus musculus OX=10090 GN=Ncan PE=1 SV=1
9	AFDB:A1Z6W9	0.053	0.054	8.726E-4	1363	0.081	0.084	A1Z6W9.pdb.gz	A1Z6W9_DROME Pawn, isoform B OS=Drosophila melanogaster OX=7227 GN=pwn PE=4 SV=2
10	AFDB:O14594	0.062	0.065	1.275E-3	1321	0.085	0.090	O14594.pdb.gz	NCAN_HUMAN Neurocan core protein OS=Homo sapiens OX=9606 GN=NCAN PE=1 SV=3
11	PDB:7nycC	0.039	0.059	3.511E-3	809	0.039	0.068	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
12	AFDB:A0A2R8QK78	0.067	0.061	6.490E-3	1570	0.096	0.086	A0A2R8QK78.pdb.gz
13	PDB:4e0sB	0.040	0.053	1.518E-2	898	0.043	0.067	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
14	PDB:3t5oA	0.044	0.061	2.911E-2	871	0.041	0.067	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
15	PDB:4bxsA	0.028	0.159	2.911E-2	248	0.011	0.065	4bxsA.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
16	PDB:3b4vD	0.048	0.181	7.725E-2	213	0.028	0.183	3b4vD.pdb.gz
17	PDB:5es4B	0.059	0.101	2.413E-1	674	0.032	0.067	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
18	PDB:2ixuA	0.028	0.061	3.527E-1	338	0.018	0.074	2ixuA.pdb.gz	Elucidation of the Molecular Recognition of Bacterial Cell Wall by Modular Pneumococcal Phage Endolysin Cpl-1.
19	PDB:7nxdB	0.034	0.064	4.150E-1	690	0.013	0.026	7nxdB.pdb.gz	Structural insights into integrin alpha 5 beta 1 opening by fibronectin ligand.
20	PDB:7bwaA	0.044	0.069	5.156E-1	674	0.017	0.036	7bwaA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KQ62	0.0	2142	2868	0.750	0.366	A0A0G2KQ62_DANRE Fibrillin 2b OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=2
2	A0A8I6A897	0.0	1553	2813	0.589	0.293	A0A8I6A897_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
3	A0A8I6G7Y9	0.0	1566	2861	0.582	0.285	A0A8I6G7Y9_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
4	B6CS38	0.0	2142	2868	0.750	0.366	B6CS38_DANRE Fibrillin 2 OS=Danio rerio OX=7955 GN=fbn2 PE=1 SV=1
5	G3V9M6	0.0	1887	2872	0.669	0.326	G3V9M6_RAT Fibrillin 1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=1 SV=1
6	P35555	0.0	1888	2871	0.666	0.325	FBN1_HUMAN Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=4
7	P35556	0.0	2803	2912	1.000	0.481	FBN2_HUMAN Fibrillin-2 OS=Homo sapiens OX=9606 GN=FBN2 PE=1 SV=3
8	P98133	0.0	1884	2871	0.668	0.326	FBN1_BOVIN Fibrillin-1 OS=Bos taurus OX=9913 GN=FBN1 PE=1 SV=2
9	Q61554	0.0	1343	2873	0.467	0.228	FBN1_MOUSE Fibrillin-1 OS=Mus musculus OX=10090 GN=Fbn1 PE=1 SV=2
10	Q61555	0.0	2634	2907	0.951	0.458	FBN2_MOUSE Fibrillin-2 OS=Mus musculus OX=10090 GN=Fbn2 PE=1 SV=2
11	Q9WUH8	0.0	1882	2872	0.666	0.325	Q9WUH8_RAT Fibrillin-1 OS=Rattus norvegicus OX=10116 GN=Fbn1 PE=2 SV=1
12	B7ZLY3	9.72e-105	366	1353	0.259	0.268	B7ZLY3_HUMAN LTBP1 protein OS=Homo sapiens OX=9606 GN=LTBP1 PE=2 SV=1
13	A7YY58	1.55e-104	365	1338	0.259	0.271	A7YY58_BOVIN LTBP1 protein OS=Bos taurus OX=9913 GN=LTBP1 PE=2 SV=1
14	Q14766	1.65e-101	360	1721	0.294	0.239	LTBP1_HUMAN Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4
15	Q8CG19	5.29e-100	355	1712	0.256	0.209	LTBP1_MOUSE Latent-transforming growth factor beta-binding protein 1 OS=Mus musculus OX=10090 GN=Ltbp1 PE=1 SV=2
16	F1MF86	9.14e-98	349	1963	0.246	0.175	F1MF86_BOVIN Latent transforming growth factor beta binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=4 SV=1
17	Q28019	7.43e-97	346	1842	0.244	0.186	LTBP2_BOVIN Latent-transforming growth factor beta-binding protein 2 OS=Bos taurus OX=9913 GN=LTBP2 PE=1 SV=2
18	Q00918	1.28e-94	339	1712	0.270	0.221	LTBP1_RAT Latent-transforming growth factor beta-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ltbp1 PE=1 SV=1
19	O08999	4.84e-90	325	1813	0.268	0.207	LTBP2_MOUSE Latent-transforming growth factor beta-binding protein 2 OS=Mus musculus OX=10090 GN=Ltbp2 PE=1 SV=2
20	Q8N2S1	4.99e-85	309	1624	0.189	0.163	LTBP4_HUMAN Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12662 cEGF	1.6e-105	355.7	Complement Clr-like EGF-like
2	PF00008 EGF	1.4e-49	177.3	EGF-like domain
3	PF07974 EGF_2	36	16.1	EGF-like domain
4	PF12947 EGF_3	1.6e-31	119.5	EGF domain
5	PF07645 EGF_CA	2.5e-140	467.8	Calcium-binding EGF domain
6	PF18193 Fibrillin_U_N	8.2e-23	91.4	Fibrillin 1 unique N-terminal domain
7	PF14670 FXa_inhibition	1.1e-27	107.4	Coagulation Factor Xa inhibitory site
8	PF12661 hEGF	3.2e-35	130.8	Human growth factor-like EGF
9	PF06247 Plasmod_Pvs28	0.0031	29.1	Pvs28 EGF domain
10	PF00683 TB	7.2e-55	193.9	TB domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424571

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351807	0.952	Elastin
2	9606.ENSP00000325527	0.949	Fibrillin-1
3	9606.ENSP00000364685	0.930	Microfibrillar-associated protein 2
4	9606.ENSP00000483552	0.930	Furin
5	9606.ENSP00000470498	0.901	Fibrillin-3
6	9606.ENSP00000352455	0.883	Microfibrillar-associated protein 5
7	9606.ENSP00000327608	0.779	ADAMTS-like protein 5
8	9606.ENSP00000379350	0.720	Integrin beta-1
9	9606.ENSP00000293379	0.716	Integrin alpha-5
10	9606.ENSP00000452786	0.709	Integrin beta-3
11	9606.ENSP00000261023	0.703	Integrin alpha-V
12	9606.ENSP00000283249	0.695	Integrin beta-6
13	9606.ENSP00000346839	0.672	Fibronectin type III domain containing
14	9606.ENSP00000304408	0.648	Collagen alpha-1(III) chain
15	9606.ENSP00000322956	0.648	Microfibril-associated glycoprotein 3
16	9606.ENSP00000358894	0.638	Metal transporter CNNM2
17	9606.ENSP00000386043	0.625	Latent-transforming growth factor beta-binding protein 1
18	9606.ENSP00000345282	0.623	Alanine aminotransferase 2
19	9606.ENSP00000267812	0.617	Microfibrillar-associated protein 1
20	9606.ENSP00000360882	0.614	Collagen alpha-1(V) chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	0.999	hormone activity
GO:0043167	0.485	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0007275	0.977	multicellular organism development
GO:0048731	0.973	system development
GO:0048513	0.971	animal organ development
GO:0065007	0.955	biological regulation
GO:0050794	0.899	regulation of cellular process
GO:0009987	0.898	cellular process
GO:0050896	0.892	response to stimulus
GO:0071560	0.799	cellular response to transforming growth factor beta stimulus
GO:0048880	0.794	sensory system development
GO:0009653	0.719	anatomical structure morphogenesis
GO:0051239	0.712	regulation of multicellular organismal process
GO:0048518	0.702	positive regulation of biological process
GO:0009887	0.672	animal organ morphogenesis
GO:0051716	0.663	cellular response to stimulus
GO:0050793	0.658	regulation of developmental process
GO:0001656	0.630	metanephros development
GO:0070887	0.628	cellular response to chemical stimulus
GO:0048522	0.625	positive regulation of cellular process
GO:0045595	0.597	regulation of cell differentiation
GO:1901700	0.561	response to oxygen-containing compound
GO:0048562	0.517	embryonic organ morphogenesis
GO:0150063	0.434	visual system development
GO:0042127	0.402	regulation of cell population proliferation
GO:0010033	0.387	response to organic substance
GO:0048519	0.319	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.998	cell periphery
GO:0062023	0.990	collagen-containing extracellular matrix
GO:0099512	0.956	supramolecular fiber
GO:0001527	0.933	microfibril
GO:0005622	0.879	intracellular anatomical structure
GO:0005737	0.805	cytoplasm
GO:0005615	0.514	extracellular space
GO:0043226	0.313	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]