StarFunc result for job id P35558

User Input

>input (622 residues)
MPPQLQNGLNLSAKVVQGSLDSLPQAVREFLENNAELCQPDHIHICDGSEEENGRLLGQM
EEEGILRRLKKYDNCWLALTDPRDVARIESKTVIVTQEQRDTVPIPKTGLSQLGRWMSEE
DFEKAFNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPV
LEAVGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLASGVTITSWKNKEWSSEDGEPCAHPNSRFCTPASQCPIIDAAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRIDGKASTKLTPIGYIPKEDALNLKGLGHINMMELFSISKEFWEKEVEDIEKYLEDQV
NADLPCEIEREILALKQRISQM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3dt7A	0.996	0.993	0.000	624	0.908	0.905	3dt7A.pdb.gz	Enzymes with lid-gated active sites must operate by an induced fit mechanism instead of conformational selection.
2	PDB:5v95A	0.938	0.985	0.000	592	0.860	0.904	5v95A.pdb.gz	Asymmetric Anchoring Is Required for Efficient Omega-Loop Opening and Closing in Cytosolic Phosphoenolpyruvate Carboxykinase.
3	AFDB:A0A4X1UM84	0.999	0.999	0.000	622	0.863	0.863	A0A4X1UM84.pdb.gz	PCKGC_PIG Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Sus scrofa OX=9823 GN=PCK1 PE=1 SV=2
4	AFDB:F1QYH3	0.985	0.973	0.000	630	0.738	0.729	F1QYH3.pdb.gz
5	AFDB:P05153	0.993	0.993	0.000	622	0.838	0.838	P05153.pdb.gz	PCKGC_CHICK Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Gallus gallus OX=9031 GN=PCK1 PE=2 SV=1
6	AFDB:P07379	0.998	0.998	0.000	622	0.908	0.908	P07379.pdb.gz	PCKGC_RAT Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Rattus norvegicus OX=10116 GN=Pck1 PE=1 SV=1
7	AFDB:P21642	0.968	0.939	0.000	641	0.627	0.608	P21642.pdb.gz	PCKGM_CHICK Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Gallus gallus OX=9031 GN=PCK2 PE=1 SV=2
8	AFDB:Q98T97	0.965	0.946	0.000	635	0.672	0.658	Q98T97.pdb.gz	Q98T97_ONCMY phosphoenolpyruvate carboxykinase (GTP) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	AFDB:O44906	0.966	0.923	1.125E-103	651	0.563	0.538	O44906.pdb.gz	O44906_CAEEL phosphoenolpyruvate carboxykinase (GTP) OS=Caenorhabditis elegans OX=6239 GN=pck-1 PE=1 SV=2
10	AFDB:F1LQJ7	0.962	0.934	2.127E-102	641	0.614	0.596	F1LQJ7.pdb.gz	F1LQJ7_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=3
11	AFDB:H0YM31	0.744	0.908	8.073E-85	509	0.556	0.680	H0YM31.pdb.gz	H0YM31_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=2
12	AFDB:P9WIH3	0.921	0.945	8.552E-85	606	0.506	0.520	P9WIH3.pdb.gz	PCKG_MYCTU Phosphoenolpyruvate carboxykinase [GTP] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pckG PE=1 SV=1
13	PDB:4r43A	0.907	0.939	6.214E-84	601	0.508	0.526	4r43A.pdb.gz	Structural and Functional Studies of Phosphoenolpyruvate Carboxykinase from Mycobacterium tuberculosis.
14	PDB:1os1A	0.670	0.765	4.058E-24	537	0.151	0.175	1os1A.pdb.gz	Mechanisms of activation of phosphoenolpyruvate carboxykinase from Escherichia coli by Ca2+ and of desensitization by trypsin.
15	PDB:3emvA	0.107	0.196	9.207E-1	246	0.040	0.102	3emvA.pdb.gz
16	PDB:7kq8A	0.085	0.145	1.094	294	0.050	0.105	7kq8A.pdb.gz	MEMO1 is an Iron Containing Regulator of Metal Homeostasis in the Cell
17	PDB:3blvH	0.072	0.096	1.546	348	0.047	0.083	3blvH.pdb.gz	Allosteric Motions in Structures of Yeast NAD+-specific Isocitrate Dehydrogenase.
18	PDB:5g5gB	0.042	0.074	1.546	316	0.014	0.028	5g5gB.pdb.gz	The Escherichia Coli Periplasmic Aldehyde Oxidoreductase is an Exceptional Member of the Xanthine Oxidase Family of Molybdoenzymes.
19	PDB:3acpA	0.038	0.050	1.637	417	0.021	0.031	3acpA.pdb.gz
20	PDB:3bsfA	0.101	0.205	1.637	244	0.035	0.090	3bsfA.pdb.gz	Crystal structure of the MTA/SAH nucleosidase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A384MTT2	0.0	946	640	0.703	0.683	A0A384MTT2_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=2 SV=1
2	A0A4X1UM84	0.0	1147	622	0.865	0.865	PCKGC_PIG Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Sus scrofa OX=9823 GN=PCK1 PE=1 SV=2
3	A0A8I5ZVZ5	0.0	833	615	0.637	0.644	A0A8I5ZVZ5_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=1
4	A0A8I6AH39	0.0	942	645	0.701	0.676	A0A8I6AH39_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=1
5	B2RYG2	0.0	944	663	0.701	0.658	B2RYG2_RAT phosphoenolpyruvate carboxykinase (GTP) (Fragment) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=2 SV=1
6	F1LQJ7	0.0	943	667	0.701	0.654	F1LQJ7_RAT phosphoenolpyruvate carboxykinase (GTP) OS=Rattus norvegicus OX=10116 GN=Pck2 PE=1 SV=3
7	H0YM31	0.0	740	509	0.553	0.676	H0YM31_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=2
8	H0YML5	0.0	743	474	0.563	0.738	H0YML5_HUMAN phosphoenolpyruvate carboxykinase (GTP) OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=1
9	O44906	0.0	738	651	0.569	0.544	O44906_CAEEL phosphoenolpyruvate carboxykinase (GTP) OS=Caenorhabditis elegans OX=6239 GN=pck-1 PE=1 SV=2
10	P05153	0.0	1113	622	0.838	0.838	PCKGC_CHICK Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Gallus gallus OX=9031 GN=PCK1 PE=2 SV=1
11	P07379	0.0	1189	622	0.908	0.908	PCKGC_RAT Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Rattus norvegicus OX=10116 GN=Pck1 PE=1 SV=1
12	P21642	0.0	833	641	0.624	0.605	PCKGM_CHICK Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Gallus gallus OX=9031 GN=PCK2 PE=1 SV=2
13	P35558	0.0	1288	622	1.000	1.000	PCKGC_HUMAN Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Homo sapiens OX=9606 GN=PCK1 PE=1 SV=3
14	P9WIH3	0.0	604	606	0.513	0.526	PCKG_MYCTU Phosphoenolpyruvate carboxykinase [GTP] OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pckG PE=1 SV=1
15	Q16822	0.0	946	640	0.703	0.683	PCKGM_HUMAN Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Homo sapiens OX=9606 GN=PCK2 PE=1 SV=4
16	Q7T3G9	0.0	995	630	0.736	0.727	Q7T3G9_DANRE phosphoenolpyruvate carboxykinase (GTP) OS=Danio rerio OX=7955 GN=cb924 PE=2 SV=1
17	Q8BH04	0.0	937	640	0.693	0.673	PCKGM_MOUSE Phosphoenolpyruvate carboxykinase [GTP], mitochondrial OS=Mus musculus OX=10090 GN=Pck2 PE=1 SV=1
18	Q98T97	0.0	888	635	0.674	0.660	Q98T97_ONCMY phosphoenolpyruvate carboxykinase (GTP) OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
19	Q9Z2V4	0.0	1187	622	0.908	0.908	PCKGC_MOUSE Phosphoenolpyruvate carboxykinase, cytosolic [GTP] OS=Mus musculus OX=10090 GN=Pck1 PE=1 SV=1
20	O94706	2.0	33.1	222	0.031	0.086	TAF8_SCHPO Transcription initiation factor TFIID subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=taf8 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00821 PEPCK_GTP	1.8e-165	561.7	Phosphoenolpyruvate carboxykinase C-terminal P-loop domain
2	PF17297 PEPCK_N	9.5e-92	318.1	Phosphoenolpyruvate carboxykinase N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319814

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377532	0.981	Pyruvate carboxylase, mitochondrial
2	9606.ENSP00000339933	0.970	Pyruvate kinase PKLR
3	9606.ENSP00000264867	0.968	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha
4	9606.ENSP00000368880	0.967	Forkhead box protein O1
5	9606.ENSP00000287820	0.961	Peroxisome proliferator-activated receptor gamma
6	9606.ENSP00000320171	0.954	Pyruvate kinase PKM
7	9606.ENSP00000263253	0.952	Histone acetyltransferase p300
8	9606.ENSP00000253792	0.951	ATP-citrate synthase
9	9606.ENSP00000438144	0.951	Malate dehydrogenase, cytoplasmic
10	9606.ENSP00000342056	0.947	Citrate synthase, mitochondrial
11	9606.ENSP00000234590	0.945	Alpha-enolase
12	9606.ENSP00000327070	0.944	Malate dehydrogenase, mitochondrial
13	9606.ENSP00000385824	0.943	Forkhead box protein O3
14	9606.ENSP00000477707	0.943	Oxysterols receptor LXR-alpha
15	9606.ENSP00000324105	0.938	Beta-enolase
16	9606.ENSP00000437402	0.932	Gamma-enolase
17	9606.ENSP00000345555	0.930	Enolase 4
18	9606.ENSP00000363817	0.930	Retinoic acid receptor RXR-beta
19	9606.ENSP00000300651	0.927	Mediator of RNA polymerase II transcription subunit 1
20	9606.ENSP00000399968	0.926	Nuclear receptor coactivator 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004613	0.999	phosphoenolpyruvate carboxykinase (GTP) activity
GO:0005488	0.989	binding
GO:0097159	0.951	organic cyclic compound binding
GO:1901363	0.715	heterocyclic compound binding
GO:0016740	0.420	transferase activity
GO:0005515	0.371	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044237	0.994	cellular metabolic process
GO:0071704	0.992	organic substance metabolic process
GO:0044238	0.990	primary metabolic process
GO:0019752	0.977	carboxylic acid metabolic process
GO:1901576	0.950	organic substance biosynthetic process
GO:0006094	0.911	gluconeogenesis
GO:0050896	0.904	response to stimulus
GO:0043648	0.861	dicarboxylic acid metabolic process
GO:0034284	0.852	response to monosaccharide
GO:0009746	0.684	response to hexose
GO:0051716	0.683	cellular response to stimulus
GO:0042592	0.626	homeostatic process
GO:0009749	0.622	response to glucose
GO:0048878	0.557	chemical homeostasis
GO:0065007	0.495	biological regulation
GO:0050789	0.467	regulation of biological process
GO:0070887	0.417	cellular response to chemical stimulus
GO:0032787	0.411	monocarboxylic acid metabolic process
GO:0050794	0.388	regulation of cellular process
GO:1901701	0.326	cellular response to oxygen-containing compound
GO:0071310	0.325	cellular response to organic substance
GO:0019222	0.313	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.909	intracellular organelle
GO:0043227	0.881	membrane-bounded organelle
GO:0043231	0.771	intracellular membrane-bounded organelle
GO:0005634	0.493	nucleus
GO:0070013	0.324	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10388	0.999	GTP + oxaloacetate = CO2 + GDP + phosphoenolpyruvate
EC:4.1.1.32	0.999	phosphoenolpyruvate carboxykinase (GTP).
EC:2.-.-.-	0.420	Transferases.

[back to server]