StarFunc result for job id P35568

User Input

>input (1242 residues)
MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPARLEYYENEKKWRHKSSAP
KRSIPLESCFNINKRADSKNKHLVALYTRDEHFAIAADSEAEQDSWYQALLQLHNRAKGH
HDGAAALGAGGGGGSCSGSSGLGEAGEDLSYGDVPPGPAFKEVWQVILKPKGLGQTKNLI
GIYRLCLTSKTISFVKLNSEAAAVVLQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQV
DDSVVAQNMHETILEAMRAMSDEFRPRSKSQSSSNCSNPISVPLRRHHLNNPPPSQVGLT
RRSRTESITATSPASMVGGKPGSFRVRASSDGEGTMSRPASVDGSPVSPSTNRTHAHRHR
GSARLHPPLNHSRSIPMPASRCSPSATSPVSLSSSSTSGHGSTSDCLFPRRSSASVSGSP
SDGGFISSDEYGSSPCDFRSSFRSVTPDSLGHTPPARGEEELSNYICMGGKGPSTLTAPN
GHYILSRGGNGHRCTPGTGLGTSPALAGDEAASAADLDNRFRKRTHSAGTSPTITHQKTP
SQSSVASIEEYTEMMPAYPPGGGSGGRLPGHRHSAFVPTRSYPEEGLEMHPLERRGGHHR
PDSSTLHTDDGYMPMSPGVAPVPSGRKGSGDYMPMSPKSVSAPQQIINPIRRHPQRVDPN
GYMMMSPSGGCSPDIGGGPSSSSSSSNAVPSGTSYGKLWTNGVGGHHSHVLPHPKPPVES
SGGKLLPCTGDYMNMSPVGDSNTSSPSDCYYGPEDPQHKPVLSYYSLPRSFKHTQRPGEP
EEGARHQHLRLSTSSGRLLYAATADDSSSSTSSDSLGGGYCGARLEPSLPHPHHQVLQPH
LPRKVDTAAQTNSRLARPTRLSLGDPKASTLPRAREQQQQQQPLLHPPEPKSPGEYVNIE
FGSDQSGYLSGPVAFHSSPSVRCPSQLQPAPREEETGTEEYMKMDLGPGRRAAWQESTGV
EMGRLGPAPPGAASICRPTRAVPSSRGDYMTMQMSCPRQSYVDTSPAAPVSYADMRTGIA
AEEVSLPRATMAAASSSSAASASPTGPQGAAELAAHSSLLGGPQGPGGMSAFTRVNLSPN
RNQSAKVIRADPQGCRRRHSSETFSSTPSATRVGNTVPFGAGAAVGGGGGSSSSSEDVKR
HSSASFENVWLRPGELGGAPKEPAKLCGAAGGLENGLNYIDLDLVKDFKQCPQECTPEPQ
PPPPPPPHQPLGSGESSSTRRSSEDLSAYASISFQKQPEDRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35568	0.999	0.999	0.000	1242	1.000	1.000	P35568.pdb.gz	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
2	AFDB:E7F4P8	0.257	0.286	2.000E-79	1099	0.561	0.634	E7F4P8.pdb.gz	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
3	AFDB:F1MAL5	0.190	0.179	3.464E-53	1327	0.412	0.386	F1MAL5.pdb.gz	F1MAL5_RAT Insulin receptor substrate 2 OS=Rattus norvegicus OX=10116 GN=Irs2 PE=1 SV=2
4	AFDB:Q9Y4H2	0.188	0.176	2.206E-52	1338	0.424	0.394	Q9Y4H2.pdb.gz	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
5	AFDB:Q9DF49	0.203	0.232	2.461E-51	1074	0.370	0.427	Q9DF49.pdb.gz	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
6	AFDB:F1QHL0	0.202	0.240	5.384E-50	1032	0.374	0.451	F1QHL0.pdb.gz
7	AFDB:Q91615	0.081	0.109	2.570E-46	885	0.462	0.649	Q91615.pdb.gz	IRS1A_XENLA Insulin receptor substrate 1-A OS=Xenopus laevis OX=8355 GN=irs1-a PE=1 SV=1
8	AFDB:Q9Z0Y7	0.187	0.191	1.779E-34	1216	0.252	0.257	Q9Z0Y7.pdb.gz	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
9	AFDB:O14654	0.182	0.180	2.634E-34	1257	0.253	0.250	O14654.pdb.gz	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
10	AFDB:Q9XTN2	0.176	0.223	1.323E-28	968	0.184	0.236	Q9XTN2.pdb.gz	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
11	PDB:3ljuX	0.109	0.290	5.701E-5	373	0.031	0.102	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
12	PDB:3pvuA	0.075	0.149	6.745E-5	609	0.020	0.041	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
13	PDB:7c3mA	0.079	0.155	9.990E-5	577	0.034	0.073	7c3mA.pdb.gz
14	PDB:4mk0A	0.081	0.155	1.479E-4	631	0.021	0.041	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
15	PDB:6xtbE	0.066	0.278	7.116E-4	235	0.027	0.145	6xtbE.pdb.gz
16	PDB:6bbpA	0.071	0.162	9.420E-4	520	0.022	0.052	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:6u3eA	0.064	0.191	9.964E-4	397	0.021	0.065	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
18	PDB:3uzsA	0.075	0.149	1.179E-3	609	0.021	0.043	3uzsA.pdb.gz	Molecular mechanism for inhibition of g protein-coupled receptor kinase 2 by a selective RNA aptamer.
19	PDB:6hhgA	0.076	0.219	1.319E-3	386	0.022	0.070	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:7nkyO	0.050	0.130	1.953E-3	427	0.027	0.077	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F4P8	0.0	1049	1099	0.562	0.635	E7F4P8_DANRE Insulin receptor substrate 1 OS=Danio rerio OX=7955 GN=irs1 PE=4 SV=1
2	P35568	0.0	2522	1242	1.000	1.000	IRS1_HUMAN Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1
3	P35569	0.0	1910	1233	0.882	0.888	IRS1_MOUSE Insulin receptor substrate 1 OS=Mus musculus OX=10090 GN=Irs1 PE=1 SV=1
4	P35570	0.0	1932	1235	0.890	0.895	IRS1_RAT Insulin receptor substrate 1 OS=Rattus norvegicus OX=10116 GN=Irs1 PE=1 SV=1
5	Q91615	0.0	788	885	0.472	0.662	IRS1A_XENLA Insulin receptor substrate 1-A OS=Xenopus laevis OX=8355 GN=irs1-a PE=1 SV=1
6	Q9DF49	0.0	563	1074	0.366	0.423	IRS2A_XENLA Insulin receptor substrate 2-A OS=Xenopus laevis OX=8355 GN=irs2-a PE=2 SV=2
7	Q7ZU74	3.13e-175	547	1032	0.378	0.455	Q7ZU74_DANRE Insulin receptor substrate 2 OS=Danio rerio OX=7955 GN=irs2a PE=2 SV=1
8	P81122	3.15e-160	515	1321	0.335	0.315	IRS2_MOUSE Insulin receptor substrate 2 OS=Mus musculus OX=10090 GN=Irs2 PE=1 SV=2
9	Q9Y4H2	1.09e-158	512	1338	0.339	0.315	IRS2_HUMAN Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2
10	O14654	8.65e-78	283	1257	0.138	0.136	IRS4_HUMAN Insulin receptor substrate 4 OS=Homo sapiens OX=9606 GN=IRS4 PE=1 SV=1
11	Q9Z0Y7	3.36e-74	272	1216	0.115	0.118	IRS4_MOUSE Insulin receptor substrate 4 OS=Mus musculus OX=10090 GN=Irs4 PE=1 SV=2
12	O08724	6.63e-50	187	494	0.089	0.225	O08724_RAT Insulin receptor substrate-3 OS=Rattus norvegicus OX=10116 GN=Irs3 PE=2 SV=1
13	B1WBQ1	6.75e-50	187	494	0.089	0.225	B1WBQ1_RAT Insulin receptor substrate 3 OS=Rattus norvegicus OX=10116 GN=Irs3 PE=4 SV=1
14	Q4QQK2	5.55e-47	174	362	0.087	0.298	Q4QQK2_MOUSE Insulin receptor substrate 3 OS=Mus musculus OX=10090 GN=Irs3 PE=2 SV=1
15	O54718	8.14e-46	175	495	0.087	0.218	O54718_MOUSE Insulin receptor substrate-3 (Fragment) OS=Mus musculus OX=10090 GN=Irs3 PE=2 SV=1
16	Q9XTN2	7.32e-39	159	968	0.081	0.103	IRS1_DROME Insulin receptor substrate 1 OS=Drosophila melanogaster OX=7227 GN=chico PE=1 SV=1
17	O70360	2.16e-32	131	332	0.110	0.410	O70360_RAT Insulin receptor substrate 2 (Fragment) OS=Rattus norvegicus OX=10116 GN=IRS-2 PE=2 SV=1
18	Q9Z1S8	9.44e-09	62.0	665	0.031	0.059	GAB2_MOUSE GRB2-associated-binding protein 2 OS=Mus musculus OX=10090 GN=Gab2 PE=1 SV=2
19	Q9EQH1	1.06e-08	62.0	665	0.031	0.059	GAB2_RAT GRB2-associated-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Gab2 PE=1 SV=2
20	Q9UQC2	7.21e-08	59.3	676	0.029	0.053	GAB2_HUMAN GRB2-associated-binding protein 2 OS=Homo sapiens OX=9606 GN=GAB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02174 IRS	3.6e-28	108.7	PTB domain (IRS-1 type)
2	PF00169 PH	1.7e-06	39.8	PH domain
3	PF15413 PH_11	1.1	21.1	Pleckstrin homology domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304895

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222254	0.999	Phosphatidylinositol 3-kinase regulatory subunit beta
2	9606.ENSP00000262741	0.999	Phosphatidylinositol 3-kinase regulatory subunit gamma
3	9606.ENSP00000263967	0.999	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
4	9606.ENSP00000268035	0.999	Insulin-like growth factor 1 receptor
5	9606.ENSP00000303830	0.999	Insulin receptor
6	9606.ENSP00000340944	0.999	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000371067	0.999	Tyrosine-protein kinase JAK2
8	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
9	9606.ENSP00000428056	0.999	Phosphatidylinositol 3-kinase regulatory subunit alpha
10	9606.ENSP00000302665	0.997	Insulin-like growth factor I
11	9606.ENSP00000380432	0.997	Insulin
12	9606.ENSP00000401303	0.997	SHC-transforming protein 1
13	9606.ENSP00000343204	0.996	Tyrosine-protein kinase JAK1
14	9606.ENSP00000225577	0.994	Ribosomal protein S6 kinase beta-1
15	9606.ENSP00000330341	0.994	Suppressor of cytokine signaling 3
16	9606.ENSP00000354558	0.994	Serine/threonine-protein kinase mTOR
17	9606.ENSP00000362680	0.994	Proto-oncogene tyrosine-protein kinase Src
18	9606.ENSP00000329418	0.991	Suppressor of cytokine signaling 1
19	9606.ENSP00000372088	0.991	DNA repair protein RAD51 homolog 1
20	9606.ENSP00000307272	0.989	Regulatory-associated protein of mTOR

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043548	0.999	phosphatidylinositol 3-kinase binding
GO:0005068	0.999	transmembrane receptor protein tyrosine kinase adaptor activity
GO:0005158	0.998	insulin receptor binding
GO:0005159	0.996	insulin-like growth factor receptor binding
GO:0001784	0.919	phosphotyrosine residue binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0009893	0.988	positive regulation of metabolic process
GO:0007165	0.986	signal transduction
GO:0031323	0.983	regulation of cellular metabolic process
GO:0048583	0.979	regulation of response to stimulus
GO:0010646	0.979	regulation of cell communication
GO:0070887	0.977	cellular response to chemical stimulus
GO:0023051	0.973	regulation of signaling
GO:0048522	0.971	positive regulation of cellular process
GO:0048519	0.966	negative regulation of biological process
GO:0008286	0.965	insulin receptor signaling pathway
GO:0048523	0.964	negative regulation of cellular process
GO:0080090	0.960	regulation of primary metabolic process
GO:0045834	0.952	positive regulation of lipid metabolic process
GO:0031325	0.948	positive regulation of cellular metabolic process
GO:0060255	0.947	regulation of macromolecule metabolic process
GO:0009966	0.946	regulation of signal transduction
GO:0051049	0.939	regulation of transport
GO:0048584	0.933	positive regulation of response to stimulus
GO:0023056	0.908	positive regulation of signaling
GO:0010647	0.908	positive regulation of cell communication
GO:0009967	0.874	positive regulation of signal transduction
GO:0065009	0.860	regulation of molecular function
GO:0019220	0.854	regulation of phosphate metabolic process
GO:0008152	0.790	metabolic process
GO:0065008	0.788	regulation of biological quality
GO:0042325	0.775	regulation of phosphorylation
GO:0050790	0.750	regulation of catalytic activity
GO:0010604	0.750	positive regulation of macromolecule metabolic process
GO:0010648	0.717	negative regulation of cell communication
GO:0023057	0.716	negative regulation of signaling
GO:0035556	0.670	intracellular signal transduction
GO:0044238	0.663	primary metabolic process
GO:0009889	0.655	regulation of biosynthetic process
GO:0071704	0.653	organic substance metabolic process
GO:0010556	0.648	regulation of macromolecule biosynthetic process
GO:0031326	0.648	regulation of cellular biosynthetic process
GO:0032502	0.647	developmental process
GO:0048009	0.615	insulin-like growth factor receptor signaling pathway
GO:1903530	0.612	regulation of secretion by cell
GO:0051171	0.601	regulation of nitrogen compound metabolic process
GO:0090087	0.590	regulation of peptide transport
GO:0051338	0.584	regulation of transferase activity
GO:0044237	0.559	cellular metabolic process
GO:0032501	0.555	multicellular organismal process
GO:0043549	0.553	regulation of kinase activity
GO:1900076	0.527	regulation of cellular response to insulin stimulus
GO:0042127	0.526	regulation of cell population proliferation
GO:0006950	0.480	response to stress
GO:0051239	0.432	regulation of multicellular organismal process
GO:0048856	0.428	anatomical structure development
GO:1900078	0.427	positive regulation of cellular response to insulin stimulus
GO:0051173	0.416	positive regulation of nitrogen compound metabolic process
GO:0060341	0.397	regulation of cellular localization
GO:0051050	0.393	positive regulation of transport
GO:0032880	0.380	regulation of protein localization
GO:0044093	0.365	positive regulation of molecular function
GO:0051246	0.363	regulation of protein metabolic process
GO:0031328	0.350	positive regulation of cellular biosynthetic process
GO:0010557	0.346	positive regulation of macromolecule biosynthetic process
GO:0051223	0.341	regulation of protein transport
GO:0010468	0.335	regulation of gene expression
GO:1902531	0.327	regulation of intracellular signal transduction
GO:0009892	0.315	negative regulation of metabolic process
GO:0046626	0.309	regulation of insulin receptor signaling pathway
GO:0043085	0.301	positive regulation of catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005829	0.999	cytosol
GO:0043226	0.988	organelle
GO:0043231	0.982	intracellular membrane-bounded organelle
GO:0070013	0.867	intracellular organelle lumen
GO:0031981	0.821	nuclear lumen
GO:0005654	0.714	nucleoplasm
GO:0032991	0.678	protein-containing complex
GO:0098590	0.431	plasma membrane region
GO:0005901	0.397	caveola

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]