StarFunc result for job id P35573

User Input

>input (1532 residues)
MGHSKQIRILLLNEMEKLEKTLFRLEQGYELQFRLGPTLQGKAVTVYTNYPFPGETFNRE
KFRSLDWENPTEREDDSDKYCKLNLQQSGSFQYYFLQGNEKSGGGYIVVDPILRVGADNH
VLPLDCVTLQTFLAKCLGPFDEWESRLRVAKESGYNMIHFTPLQTLGLSRSCYSLANQLE
LNPDFSRPNRKYTWNDVGQLVEKLKKEWNVICITDVVYNHTAANSKWIQEHPECAYNLVN
SPHLKPAWVLDRALWRFSCDVAEGKYKEKGIPALIENDHHMNSIRKIIWEDIFPKLKLWE
FFQVDVNKAVEQFRRLLTQENRRVTKSDPNQHLTIIQDPEYRRFGCTVDMNIALTTFIPH
DKGPAAIEECCNWFHKRMEELNSEKHRLINYHQEQAVNCLLGNVFYERLAGHGPKLGPVT
RKHPLVTRYFTFPFEEIDFSMEESMIHLPNKACFLMAHNGWVMGDDPLRNFAEPGSEVYL
RRELICWGDSVKLRYGNKPEDCPYLWAHMKKYTEITATYFQGVRLDNCHSTPLHVAEYML
DAARNLQPNLYVVAELFTGSEDLDNVFVTRLGISSLIREAMSAYNSHEEGRLVYRYGGEP
VGSFVQPCLRPLMPAIAHALFMDITHDNECPIVHRSAYDALPSTTIVSMACCASGSTRGY
DELVPHQISVVSEERFYTKWNPEALPSNTGEVNFQSGIIAARCAISKLHQELGAKGFIQV
YVDQVDEDIVAVTRHSPSIHQSVVAVSRTAFRNPKTSFYSKEVPQMCIPGKIEEVVLEAR
TIERNTKPYRKDENSINGTPDITVEIREHIQLNESKIVKQAGVATKGPNEYIQEIEFENL
SPGSVIIFRVSLDPHAQVAVGILRNHLTQFSPHFKSGSLAVDNADPILKIPFASLASRLT
LAELNQILYRCESEEKEDGGGCYDIPNWSALKYAGLQGLMSVLAEIRPKNDLGHPFCNNL
RSGDWMIDYVSNRLISRSGTIAEVGKWLQAMFFYLKQIPRYLIPCYFDAILIGAYTTLLD
TAWKQMSSFVQNGSTFVKHLSLGSVQLCGVGKFPSLPILSPALMDVPYRLNEITKEKEQC
CVSLAAGLPHFSSGIFRCWGRDTFIALRGILLITGRYVEARNIILAFAGTLRHGLIPNLL
GEGIYARYNCRDAVWWWLQCIQDYCKMVPNGLDILKCPVSRMYPTDDSAPLPAGTLDQPL
FEVIQEAMQKHMQGIQFRERNAGPQIDRNMKDEGFNITAGVDEETGFVYGGNRFNCGTWM
DKMGESDRARNRGIPATPRDGSAVEIVGLSKSAVRWLLELSKKNIFPYHEVTVKRHGKAI
KVSYDEWNRKIQDNFEKLFHVSEDPSDLNEKHPNLVHKRGIYKDSYGASSPWCDYQLRPN
FTIAMVVAPELFTTEKAWKALEIAEKKLLGPLGMKTLDPDDMVYCGIYDNALDNDNYNLA
KGFNYHQGPEWLWPIGYFLRAKLYFSRLMGPETTAKTIVLVKNVLSRHYVHLERSPWKGL
PELTNENAQYCPFSCETQAWSIATILETLYDL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4AEH9	0.997	0.997	0.000	1532	0.921	0.921	D4AEH9.pdb.gz	D4AEH9_RAT Glycogen debranching enzyme OS=Rattus norvegicus OX=10116 GN=Agl PE=1 SV=1
2	AFDB:Q06625	0.857	0.855	0.000	1536	0.376	0.375	Q06625.pdb.gz	GDE_YEAST Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDB1 PE=1 SV=1
3	AFDB:A0A7U9P668	0.213	0.508	1.798E-11	588	0.056	0.146	A0A7U9P668.pdb.gz	CDAS_GEOTM Cyclomaltodextrinase OS=Geobacillus thermopakistaniensis (strain MAS1) OX=1408282 GN=T260_08735 PE=1 SV=1
4	AFDB:P38940	0.197	0.470	3.142E-11	588	0.055	0.143	P38940.pdb.gz	NEPU_GEOSE Neopullulanase OS=Geobacillus stearothermophilus OX=1422 GN=nplT PE=1 SV=1
5	PDB:1j0hA	0.213	0.507	4.050E-11	588	0.049	0.128	1j0hA.pdb.gz	Three-dimensional Structure and Substrate Binding of Bacillus stearothermophilus Neopullulanase
6	AFDB:P9WQ17	0.237	0.480	4.153E-11	701	0.055	0.121	P9WQ17.pdb.gz	GLGE_MYCTU Alpha-1,4-glucan:maltose-1-phosphate maltosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=glgE PE=1 SV=1
7	AFDB:Q8A1G0	0.191	0.437	8.741E-11	617	0.043	0.107	Q8A1G0.pdb.gz	SUSA_BACTN Neopullulanase SusA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=susA PE=3 SV=1
8	PDB:3k8kA	0.224	0.487	2.111E-9	650	0.055	0.129	3k8kA.pdb.gz	SusG: A Unique Cell-Membrane-Associated alpha-Amylase from a Prominent Human Gut Symbiont Targets Complex Starch Molecules.
9	AFDB:L8B068	0.214	0.453	2.608E-9	663	0.050	0.115	L8B068.pdb.gz	MALA_HALJT Alpha-amylase MalA OS=Haloarcula japonica (strain ATCC 49778 / DSM 6131 / JCM 7785 / NBRC 101032 / NCIMB 13157 / TR-1) OX=1227453 GN=malA PE=1 SV=1
10	PDB:1ea9C	0.206	0.488	3.063E-9	583	0.046	0.122	1ea9C.pdb.gz
11	AFDB:Q59226	0.187	0.467	3.141E-9	558	0.049	0.134	Q59226.pdb.gz	CDAS_BACSP Cyclomaltodextrinase OS=Bacillus sp. OX=1409 GN=CDI5 PE=1 SV=1
12	AFDB:B1XIU7	0.206	0.441	5.239E-9	661	0.054	0.126	B1XIU7.pdb.gz	B1XIU7_SYNP2 Alpha amylase (Amylosucrase), Chain A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) OX=32049 GN=ams PE=4 SV=1
13	AFDB:P21517	0.196	0.460	9.591E-9	604	0.051	0.129	P21517.pdb.gz	MALZ_ECOLI Maltodextrin glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=malZ PE=1 SV=5
14	PDB:5jy7B	0.209	0.508	3.775E-8	571	0.049	0.131	5jy7B.pdb.gz	Crystal structure of the TreS-Pep2 complex, initiating alpha-glucan synthesis in the GlgE pathway of mycobacteria.
15	PDB:4s3pA	0.147	0.283	5.477E-8	691	0.055	0.122	4s3pA.pdb.gz
16	PDB:7vt9A	0.192	0.444	7.585E-8	604	0.060	0.152	7vt9A.pdb.gz
17	PDB:6li9A	0.229	0.521	1.050E-7	623	0.048	0.117	6li9A.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
18	PDB:3a47A	0.207	0.494	1.265E-7	586	0.048	0.126	3a47A.pdb.gz	Crystal structure of isomaltase from Saccharomyces cerevisiae
19	PDB:5cltA	0.207	0.440	3.062E-7	646	0.053	0.125	5cltA.pdb.gz	Crystal structure of human glycogen branching enzyme (GBE1) in complex with acarbose
20	PDB:7p44B	0.178	0.347	6.152E-7	700	0.054	0.119	7p44B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JGI9	0.0	2483	1279	0.766	0.918	A0A0G2JGI9_MOUSE Glycogen debranching enzyme OS=Mus musculus OX=10090 GN=Agl PE=1 SV=1
2	D4AEH9	0.0	2984	1532	0.922	0.922	D4AEH9_RAT Glycogen debranching enzyme OS=Rattus norvegicus OX=10116 GN=Agl PE=1 SV=1
3	F6XXE6	0.0	1612	830	0.502	0.927	F6XXE6_MOUSE Amylo-1,6-glucosidase, 4-alpha-glucanotransferase (Fragment) OS=Mus musculus OX=10090 GN=Agl PE=1 SV=2
4	F8VPN4	0.0	2981	1532	0.919	0.919	F8VPN4_MOUSE Glycogen debranching enzyme OS=Mus musculus OX=10090 GN=Agl PE=1 SV=1
5	P35573	0.0	3207	1532	1.000	1.000	GDE_HUMAN Glycogen debranching enzyme OS=Homo sapiens OX=9606 GN=AGL PE=1 SV=3
6	Q06625	0.0	949	1536	0.397	0.396	GDE_YEAST Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDB1 PE=1 SV=1
7	Q8CE68	0.0	646	320	0.196	0.938	Q8CE68_MOUSE Glycogen debranching enzyme C-terminal domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Agl PE=2 SV=1
8	E0CYU6	7.42e-144	441	233	0.134	0.884	E0CYU6_MOUSE Amylo-1,6-glucosidase, 4-alpha-glucanotransferase OS=Mus musculus OX=10090 GN=Agl PE=1 SV=1
9	F7CSZ6	1.39e-122	382	198	0.117	0.909	F7CSZ6_MOUSE Amylo-1,6-glucosidase, 4-alpha-glucanotransferase (Fragment) OS=Mus musculus OX=10090 GN=Agl PE=1 SV=1
10	E0CX86	4.14e-70	232	116	0.072	0.948	E0CX86_MOUSE Amylo-1,6-glucosidase, 4-alpha-glucanotransferase (Fragment) OS=Mus musculus OX=10090 GN=Agl PE=1 SV=8
11	Q9LUM0	0.087	40.0	1791	0.021	0.018	FAB1B_ARATH 1-phosphatidylinositol-3-phosphate 5-kinase FAB1B OS=Arabidopsis thaliana OX=3702 GN=FAB1B PE=2 SV=1
12	B1XIU7	0.50	37.4	661	0.016	0.036	B1XIU7_SYNP2 Alpha amylase (Amylosucrase), Chain A OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) OX=32049 GN=ams PE=4 SV=1
13	Q8IA44	0.78	36.6	563	0.015	0.041	GLT12_DROME Putative inactive polypeptide N-acetylgalactosaminyltransferase 12 OS=Drosophila melanogaster OX=7227 GN=pgant12 PE=2 SV=1
14	Q8W4M7	1.9	35.4	758	0.016	0.033	ERCC2_ARATH General transcription and DNA repair factor IIH helicase subunit XPD OS=Arabidopsis thaliana OX=3702 GN=XPD PE=1 SV=1
15	A0A1D8PP39	3.2	34.7	582	0.015	0.040	A0A1D8PP39_CANAL Glycosyl hydrolase family 13 catalytic domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C504940WA PE=4 SV=1
16	P28904	3.4	34.7	551	0.014	0.038	TREC_ECOLI Trehalose-6-phosphate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=treC PE=1 SV=3
17	Q9P6R5	3.9	34.3	371	0.015	0.062	GPI14_SCHPO GPI mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi14 PE=3 SV=2
18	F4KFS5	4.3	34.7	1598	0.026	0.025	GMI1_ARATH Structural maintenance of chromosomes flexible hinge domain-containing protein GMI1 OS=Arabidopsis thaliana OX=3702 GN=GMI1 PE=2 SV=1
19	E1U8D0	7.6	33.5	1418	0.021	0.023	SOGA1_MOUSE Protein SOGA1 OS=Mus musculus OX=10090 GN=Soga1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00128 Alpha-amylase	19	16.3	Alpha amylase, catalytic domain
2	PF12930 DUF3836	4.8e+02	12.0	Family of unknown function (DUF3836)
3	PF13204 DUF4038	1.6e+02	13.4	Protein of unknown function (DUF4038)
4	PF06202 GDE_C	8.2e-143	487.5	Amylo-alpha-1,6-glucosidase
5	PF14701 hDGE_amylase	1.9e-159	543.1	Glycogen debranching enzyme, glucanotransferase domain
6	PF14702 hGDE_central	7.6e-77	270.0	Central domain of human glycogen debranching enzyme
7	PF14699 hGDE_N	3e-16	70.6	N-terminal domain from the human glycogen debranching enzyme

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294724

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000410833	0.998	1,4-alpha-glucan-branching enzyme
2	9606.ENSP00000164139	0.993	Glycogen phosphorylase, muscle form
3	9606.ENSP00000216392	0.992	Glycogen phosphorylase, liver form
4	9606.ENSP00000216962	0.992	Glycogen phosphorylase, brain form
5	9606.ENSP00000246802	0.981	Ribosome biogenesis protein NOP53
6	9606.ENSP00000340736	0.969	Glycogenin-1
7	9606.ENSP00000447378	0.965	Maltase-glucoamylase, intestinal
8	9606.ENSP00000338703	0.963	UTP--glucose-1-phosphate uridylyltransferase
9	9606.ENSP00000370555	0.943	Glycogenin-2
10	9606.ENSP00000447431	0.943	Probable maltase-glucoamylase 2
11	9606.ENSP00000371393	0.930	Phosphoglucomutase-2
12	9606.ENSP00000354238	0.917	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
13	9606.ENSP00000406261	0.916	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
14	9606.ENSP00000298198	0.908	Glucose 1,6-bisphosphate synthase
15	9606.ENSP00000317904	0.880	Glycogen [starch] synthase, muscle
16	9606.ENSP00000261195	0.856	Glycogen [starch] synthase, liver
17	9606.ENSP00000362298	0.846	Sphingosine-1-phosphate lyase 1
18	9606.ENSP00000345464	0.840	E3 ubiquitin-protein ligase NHLRC1
19	9606.ENSP00000233616	0.830	Mannosyl-oligosaccharide glucosidase
20	9606.ENSP00000354610	0.820	Amylase, alpha 2B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030247	1.000	polysaccharide binding
GO:0031593	1.000	polyubiquitin modification-dependent protein binding
GO:0004134	1.000	4-alpha-glucanotransferase activity
GO:0004135	1.000	amylo-alpha-1,6-glucosidase activity
GO:0004133	0.907	glycogen debranching enzyme activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0005975	0.903	carbohydrate metabolic process
GO:0043170	0.897	macromolecule metabolic process
GO:0006091	0.849	generation of precursor metabolites and energy
GO:0009056	0.820	catabolic process
GO:1901575	0.798	organic substance catabolic process
GO:0044262	0.742	cellular carbohydrate metabolic process
GO:0015980	0.737	energy derivation by oxidation of organic compounds
GO:0044260	0.732	cellular macromolecule metabolic process
GO:0005977	0.713	glycogen metabolic process
GO:0044248	0.697	cellular catabolic process
GO:0005980	0.646	glycogen catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.992	endomembrane system
GO:0005634	0.987	nucleus
GO:0070013	0.729	intracellular organelle lumen
GO:0031982	0.628	vesicle
GO:0005576	0.621	extracellular region
GO:1903561	0.421	extracellular vesicle
GO:0016020	0.419	membrane
GO:0070062	0.411	extracellular exosome
GO:0016234	0.372	inclusion body
GO:0016529	0.329	sarcoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.25	1.000	4-alpha-glucanotransferase.
EC:3.2.1.33	1.000	amylo-alpha-1,6-glucosidase.

[back to server]