StarFunc result for job id P35579

User Input

>input (1960 residues)
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVGEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAYVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQAEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEEQIILEDQNCKLAKEKKLLEDRIAEFTTNLTEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKTRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQAALARVEEEAAQKNMALKKIRELESQISELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEAKTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKANLEKAKQTLENERGELANEVKVLLQGKGDSEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLSQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQVEDEKNSFREQLEEEEEAKHNLEKQIATLHAQVADMKKKMEDSVGCL
ETAEEVKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSACNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDERKQRSMAVAARKKLEMDLK
DLEAHIDSANKNRDEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMEGT
VKSKYKASITALEAKIAQLEEQLDNETKERQAACKQVRRTEKKLKDVLLQVDDERRNAEQ
YKDQADKASTRLKQLKRQLEEAEEEAQRANASRRKLQRELEDATETADAMNREVSSLKNK
LRRGDLPFVVPRRMARKGAGDGSDEEVDGKADGAEAKPAE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0N4STT5	0.654	0.639	0.000	2008	0.394	0.385	A0A0N4STT5.pdb.gz
2	AFDB:A1L219	0.424	0.763	0.000	1046	0.448	0.839	A1L219.pdb.gz
3	AFDB:A7E2Y1	0.676	0.669	0.000	1983	0.395	0.390	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
4	AFDB:B1AR69	0.631	0.637	0.000	1938	0.389	0.394	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
5	AFDB:B3DFS9	0.733	0.728	0.000	1974	0.730	0.724	B3DFS9.pdb.gz
6	AFDB:B8A568	0.684	0.692	0.000	1937	0.385	0.390	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
7	AFDB:B8JLS3	0.654	0.661	0.000	1936	0.384	0.388	B8JLS3.pdb.gz
8	AFDB:E7FD18	0.672	0.676	0.000	1945	0.392	0.395	E7FD18.pdb.gz
9	AFDB:F1QC64	0.667	0.745	0.000	1749	0.713	0.799	F1QC64.pdb.gz
10	AFDB:F1R3G4	0.723	0.712	0.000	1992	0.777	0.765	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
11	PDB:7mf3B	0.370	0.789	3.833E-91	896	0.384	0.839	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
12	PDB:4pa0A	0.328	0.640	6.553E-76	974	0.200	0.402	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.328	0.676	6.192E-73	920	0.197	0.420	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4p7hB	0.325	0.648	9.031E-70	952	0.195	0.401	4p7hB.pdb.gz
15	PDB:5tbyA	0.359	0.703	5.649E-69	954	0.237	0.486	5tbyA.pdb.gz
16	PDB:4anjA	0.340	0.658	1.880E-61	995	0.145	0.285	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.359	0.825	8.032E-57	817	0.117	0.280	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:7mf3G	0.079	0.370	4.765E-9	212	0.086	0.797	7mf3G.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
19	PDB:7wrgA	0.045	0.087	6.042E-2	812	0.022	0.053	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
20	PDB:7nkxZ	0.022	0.248	2.018E-1	156	0.005	0.058	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	1057	1922	0.348	0.355	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	1271	1912	0.393	0.403	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	1289	1937	0.396	0.401	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	1302	1939	0.398	0.402	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	1283	1938	0.389	0.394	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	751	1948	0.239	0.241	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	1201	1941	0.398	0.402	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	2970	1972	0.766	0.761	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	1204	1983	0.399	0.395	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	1254	1938	0.392	0.396	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	1302	1939	0.393	0.397	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	1215	1941	0.396	0.400	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	1264	1937	0.392	0.396	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	1295	1939	0.395	0.400	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	1295	1943	0.399	0.402	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	1308	1938	0.397	0.401	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	3004	1992	0.774	0.762	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	1186	1929	0.390	0.396	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	1282	1942	0.395	0.399	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	1283	1942	0.396	0.400	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	5.5e+02	12.2	AAA domain
2	PF11559 ADIP	7.4	18.1	Afadin- and alpha -actinin-Binding
3	PF16516 CC2-LZ	1.9	20.2	Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
4	PF19220 Crescentin	1.1e+02	13.3	Crescentin protein
5	PF00612 IQ	1.2	20.1	IQ calmodulin-binding motif
6	PF00063 Myosin_head	0	1024.3	Myosin head (motor domain)
7	PF02736 Myosin_N	4.3e-09	47.3	Myosin N-terminal SH3-like domain
8	PF01576 Myosin_tail_1	0	1668.9	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216181

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357705	0.999	S100 calcium binding protein A4
2	9606.ENSP00000463559	0.998	Myosin regulatory light chain 12B
3	9606.ENSP00000446955	0.995	Myosin light polypeptide 6
4	9606.ENSP00000349960	0.980	Actin, cytoplasmic 1
5	9606.ENSP00000279022	0.979	Myosin regulatory light polypeptide 9
6	9606.ENSP00000307280	0.979	Myosin light chain 1/3, skeletal muscle isoform
7	9606.ENSP00000353590	0.979	Myosin-10
8	9606.ENSP00000217652	0.978	Myosin regulatory light chain 12A
9	9606.ENSP00000450385	0.978	Myosin light chain 6B
10	9606.ENSP00000353452	0.963	Myosin light chain kinase, smooth muscle
11	9606.ENSP00000382697	0.962	Rho-associated protein kinase 1
12	9606.ENSP00000400175	0.958	Transforming protein RhoA
13	9606.ENSP00000382177	0.953	Unconventional myosin-Va
14	9606.ENSP00000228841	0.952	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
15	9606.ENSP00000389168	0.945	Protein phosphatase 1 regulatory subunit 12A
16	9606.ENSP00000379210	0.944	Myosin light chain 3
17	9606.ENSP00000476755	0.941	Protein phosphatase 1 regulatory subunit 12B
18	9606.ENSP00000348461	0.940	Ras-related C3 botulinum toxin substrate 1
19	9606.ENSP00000376306	0.940	Citron Rho-interacting kinase
20	9606.ENSP00000470298	0.940	Myosin-14

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003774	1.000	cytoskeletal motor activity
GO:0005515	1.000	protein binding
GO:0008092	0.994	cytoskeletal protein binding
GO:0000146	0.986	microfilament motor activity
GO:0019899	0.799	enzyme binding
GO:0042802	0.784	identical protein binding
GO:0003779	0.776	actin binding
GO:0005198	0.761	structural molecule activity
GO:0008307	0.721	structural constituent of muscle
GO:0044877	0.464	protein-containing complex binding
GO:0019901	0.422	protein kinase binding
GO:0043167	0.415	ion binding
GO:1901363	0.400	heterocyclic compound binding
GO:0097159	0.394	organic cyclic compound binding
GO:0036094	0.362	small molecule binding
GO:0097367	0.361	carbohydrate derivative binding
GO:1901265	0.351	nucleoside phosphate binding
GO:0017076	0.339	purine nucleotide binding
GO:0030554	0.334	adenyl nucleotide binding
GO:0032555	0.305	purine ribonucleotide binding
GO:0043168	0.302	anion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.999	cellular process
GO:0050789	0.967	regulation of biological process
GO:0030029	0.967	actin filament-based process
GO:0032501	0.946	multicellular organismal process
GO:0007010	0.938	cytoskeleton organization
GO:0048856	0.929	anatomical structure development
GO:0050794	0.900	regulation of cellular process
GO:0030036	0.865	actin cytoskeleton organization
GO:0051179	0.712	localization
GO:0051234	0.693	establishment of localization
GO:0006810	0.676	transport
GO:0044085	0.606	cellular component biogenesis
GO:0050896	0.588	response to stimulus
GO:0097435	0.586	supramolecular fiber organization
GO:0016192	0.500	vesicle-mediated transport
GO:0048518	0.404	positive regulation of biological process
GO:0007275	0.392	multicellular organism development
GO:0051716	0.352	cellular response to stimulus
GO:0022607	0.349	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005737	1.000	cytoplasm
GO:0015629	0.999	actin cytoskeleton
GO:0032991	0.998	protein-containing complex
GO:0099080	0.995	supramolecular complex
GO:0005886	0.994	plasma membrane
GO:0005829	0.994	cytosol
GO:0031982	0.992	vesicle
GO:0012505	0.990	endomembrane system
GO:0043231	0.989	intracellular membrane-bounded organelle
GO:0005576	0.982	extracellular region
GO:0005634	0.981	nucleus
GO:0099081	0.978	supramolecular polymer
GO:0016459	0.977	myosin complex
GO:1903561	0.947	extracellular vesicle
GO:0070013	0.946	intracellular organelle lumen
GO:0070062	0.935	extracellular exosome
GO:0016460	0.879	myosin II complex
GO:0031981	0.828	nuclear lumen
GO:0005654	0.786	nucleoplasm
GO:0032432	0.761	actin filament bundle
GO:0042641	0.732	actomyosin
GO:0097517	0.713	contractile actin filament bundle
GO:0099512	0.708	supramolecular fiber
GO:0043292	0.602	contractile fiber
GO:0030054	0.595	cell junction
GO:0097708	0.563	intracellular vesicle
GO:0031410	0.521	cytoplasmic vesicle
GO:0001725	0.417	stress fiber
GO:0070161	0.354	anchoring junction
GO:0005859	0.342	muscle myosin complex
GO:0031252	0.321	cell leading edge

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.986	myosin ATPase.

[back to server]