StarFunc result for job id P35580

User Input

>input (1976 residues)
MAQRTGLEDPERYLFVDRAVIYNPATQADWTAKKLVWIPSERHGFEAASIKEERGDEVMV
ELAENGKKAMVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKDRYYSGLIYTYSGL
FCVVINPYKNLPIYSENIIEMYRGKKRHEMPPHIYAISESAYRCMLQDREDQSILCTGES
GAGKTENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSS
RFGKFIRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLSGAGEHLKSDLL
LEGFNNYRFLSNGYIPIPGQQDKDNFQETMEAMHIMGFSHEEILSMLKVVSSVLQFGNIS
FKKERNTDQASMPENTVAQKLCHLLGMNVMEFTRAILTPRIKVGRDYVQKAQTKEQADFA
VEALAKATYERLFRWLVHRINKALDRTKRQGASFIGILDIAGFEIFELNSFEQLCINYTN
EKLQQLFNHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIERPANPPGVLALLDEECW
FPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLN
DNVATLLHQSSDRFVAELWKDVDRIVGLDQVTGMTETAFGSAYKTKKGMFRTVGQLYKES
LTKLMATLRNTNPNFVRCIIPNHEKRAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRIV
FQEFRQRYEILTPNAIPKGFMDGKQACERMIRALELDPNLYRIGQSKIFFRAGVLAHLEE
ERDLKITDIIIFFQAVCRGYLARKAFAKKQQQLSALKVLQRNCAAYLKLRHWQWWRVFTK
VKPLLQVTRQEEELQAKDEELLKVKEKQTKVEGELEEMERKHQQLLEEKNILAEQLQAET
ELFAEAEEMRARLAAKKQELEEILHDLESRVEEEEERNQILQNEKKKMQAHIQDLEEQLD
EEEGARQKLQLEKVTAEAKIKKMEEEILLLEDQNSKFIKEKKLMEDRIAECSSQLAEEEE
KAKNLAKIRNKQEVMISDLEERLKKEEKTRQELEKAKRKLDGETTDLQDQIAELQAQIDE
LKLQLAKKEEELQGALARGDDETLHKNNALKVVRELQAQIAELQEDFESEKASRNKAEKQ
KRDLSEELEALKTELEDTLDTTAAQQELRTKREQEVAELKKALEEETKNHEAQIQDMRQR
HATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQ
VQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASLESQLQDT
QELLQEETRQKLNLSSRIRQLEEEKNSLQEQQEEEEEARKNLEKQVLALQSQLADTKKKV
DDDLGTIESLEEAKKKLLKDAEALSQRLEEKALAYDKLEKTKNRLQQELDDLTVDLDHQR
QVASNLEKKQKKFDQLLAEEKSISARYAEERDRAEAEAREKETKALSLARALEEALEAKE
EFERQNKQLRADMEDLMSSKDDVGKNVHELEKSKRALEQQVEEMRTQLEELEDELQATED
AKLRLEVNMQAMKAQFERDLQTRDEQNEEKKRLLIKQVRELEAELEDERKQRALAVASKK
KMEIDLKDLEAQIEAANKARDEVIKQLRKLQAQMKDYQRELEEARASRDEIFAQSKESEK
KLKSLEAEILQLQEELASSERARRHAEQERDELADEITNSASGKSALLDEKRRLEARIAQ
LEEELEEEQSNMELLNDRFRKTTLQVDTLNAELAAERSAAQKSDNARQQLERQNKELKAK
LQELEGAVKSKFKATISALEAKIGQLEEQLEQEAKERAAANKLVRRTEKKLKEIFMQVED
ERRHADQYKEQMEKANARMKQLKRQLEEAEEEATRANASRRKLQRELDDATEANEGLSRE
VSTLKNRLRRGGPISFSSSRSGRRQLHLEGASLELSDDDTESKTSDVNETQPPQSE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0N4STT5	0.665	0.655	0.000	2008	0.388	0.382	A0A0N4STT5.pdb.gz
2	AFDB:A1L219	0.421	0.768	0.000	1046	0.412	0.779	A1L219.pdb.gz
3	AFDB:A7E2Y1	0.650	0.648	0.000	1983	0.397	0.396	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
4	AFDB:B1AR69	0.645	0.657	0.000	1938	0.385	0.392	B1AR69.pdb.gz	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
5	AFDB:B3DFS9	0.757	0.757	0.000	1974	0.716	0.716	B3DFS9.pdb.gz
6	AFDB:B8A568	0.710	0.723	0.000	1937	0.381	0.389	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
7	AFDB:B8JLS3	0.693	0.706	0.000	1936	0.376	0.383	B8JLS3.pdb.gz
8	AFDB:E7FD18	0.696	0.706	0.000	1945	0.389	0.395	E7FD18.pdb.gz
9	AFDB:F1QC64	0.677	0.762	0.000	1749	0.652	0.736	F1QC64.pdb.gz
10	AFDB:F1R3G4	0.818	0.812	0.000	1992	0.900	0.893	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
11	PDB:7mf3B	0.368	0.791	8.394E-93	896	0.383	0.844	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
12	PDB:4pa0A	0.319	0.625	1.196E-75	974	0.198	0.402	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.323	0.671	3.015E-72	920	0.193	0.414	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4p7hB	0.318	0.640	7.973E-69	952	0.192	0.399	4p7hB.pdb.gz
15	PDB:5tbyA	0.360	0.709	1.814E-68	954	0.235	0.486	5tbyA.pdb.gz
16	PDB:4anjA	0.338	0.658	1.645E-60	995	0.138	0.274	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.359	0.831	2.144E-56	817	0.113	0.274	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6zmwu	0.055	0.094	3.173E-2	706	0.053	0.149	6zmwu.pdb.gz	Structure of a human 48Stranslational initiation complex.
19	PDB:7nkxZ	0.024	0.277	1.992E-1	156	0.007	0.083	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:5cskB	0.040	0.040	2.933E-1	2017	0.022	0.022	5cskB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	1078	1922	0.351	0.361	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	1269	1912	0.386	0.399	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	1274	1937	0.388	0.395	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	1283	1939	0.387	0.394	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	1266	1938	0.385	0.393	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	764	1948	0.236	0.240	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	1209	1941	0.394	0.401	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	2983	1972	0.759	0.761	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	1216	1983	0.395	0.394	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	1248	1938	0.386	0.393	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	1293	1939	0.390	0.397	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	1222	1941	0.393	0.400	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	1249	1937	0.383	0.390	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	1275	1939	0.387	0.394	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	1280	1943	0.389	0.396	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	1283	1938	0.391	0.398	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	3494	1992	0.901	0.894	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	1189	1929	0.386	0.396	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	1280	1942	0.388	0.394	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	1283	1942	0.387	0.393	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	2.9e+02	13.2	AAA domain
2	PF11559 ADIP	0.34	22.5	Afadin- and alpha -actinin-Binding
3	PF16516 CC2-LZ	0.92	21.3	Leucine zipper of domain CC2 of NEMO, NF-kappa-B essential modulator
4	PF20492 ERM_helical	18	16.8	Ezrin/radixin/moesin, alpha-helical domain
5	PF00612 IQ	0.27	22.1	IQ calmodulin-binding motif
6	PF00063 Myosin_head	0	1022.9	Myosin head (motor domain)
7	PF02736 Myosin_N	1.4e-11	55.2	Myosin N-terminal SH3-like domain
8	PF01576 Myosin_tail_1	0	1727.2	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000014897

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000008645	0.972	Uncharacterized protein
2	9598.ENSPTRP00000023100	0.972	Myosin, light chain 9, regulatory
3	9598.ENSPTRP00000008643	0.971	Uncharacterized protein
4	9598.ENSPTRP00000016740	0.955	Uncharacterized protein
5	9598.ENSPTRP00000048538	0.946	Myosin, heavy chain 14, non-muscle
6	9598.ENSPTRP00000016741	0.944	Uncharacterized protein
7	9598.ENSPTRP00000033436	0.940	Uncharacterized protein
8	9598.ENSPTRP00000013669	0.934	Myosin light chain, phosphorylatable, fast skeletal muscle
9	9598.ENSPTRP00000058292	0.934	Actin, cytoplasmic 1
10	9598.ENSPTRP00000022020	0.861	Uncharacterized protein
11	9598.ENSPTRP00000057889	0.856	Myosin, light chain 5, regulatory
12	9598.ENSPTRP00000025619	0.848	Myosin, light chain 3, alkali
13	9598.ENSPTRP00000045525	0.848	Myosin, light chain 4, alkali atrial, embryonic
14	9598.ENSPTRP00000012761	0.845	Uncharacterized protein
15	9598.ENSPTRP00000015378	0.845	Uncharacterized protein
16	9598.ENSPTRP00000032689	0.842	Uncharacterized protein
17	9598.ENSPTRP00000059273	0.822	Uncharacterized protein
18	9598.ENSPTRP00000024645	0.820	Myosin, heavy chain 9, non-muscle
19	9598.ENSPTRP00000003821	0.794	Belongs to the calmodulin family.
20	9598.ENSPTRP00000033766	0.792	Exocyst complex component 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.995	protein binding
GO:0008092	0.991	cytoskeletal protein binding
GO:0003774	0.989	cytoskeletal motor activity
GO:0000146	0.979	microfilament motor activity
GO:0003779	0.957	actin binding
GO:0042802	0.942	identical protein binding
GO:0043167	0.926	ion binding
GO:0043168	0.921	anion binding
GO:0035639	0.894	purine ribonucleoside triphosphate binding
GO:0005524	0.852	ATP binding
GO:0044877	0.809	protein-containing complex binding
GO:0051015	0.740	actin filament binding
GO:0019899	0.705	enzyme binding
GO:0043531	0.410	ADP binding
GO:0046872	0.401	metal ion binding
GO:0019901	0.342	protein kinase binding
GO:0003824	0.314	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0071840	0.984	cellular component organization or biogenesis
GO:0030029	0.955	actin filament-based process
GO:0007010	0.952	cytoskeleton organization
GO:0065007	0.943	biological regulation
GO:0032501	0.938	multicellular organismal process
GO:0097435	0.936	supramolecular fiber organization
GO:0048856	0.909	anatomical structure development
GO:0030036	0.893	actin cytoskeleton organization
GO:0007275	0.889	multicellular organism development
GO:0050789	0.830	regulation of biological process
GO:0007015	0.828	actin filament organization
GO:0048731	0.782	system development
GO:0048513	0.596	animal organ development
GO:0022604	0.538	regulation of cell morphogenesis
GO:0050794	0.529	regulation of cellular process
GO:0008360	0.456	regulation of cell shape
GO:0050896	0.433	response to stimulus
GO:0007399	0.381	nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.996	cytoplasm
GO:0015629	0.996	actin cytoskeleton
GO:0032991	0.995	protein-containing complex
GO:0043227	0.992	membrane-bounded organelle
GO:0071944	0.991	cell periphery
GO:0016459	0.984	myosin complex
GO:0031982	0.983	vesicle
GO:0099080	0.981	supramolecular complex
GO:0005829	0.981	cytosol
GO:0005886	0.975	plasma membrane
GO:0043231	0.970	intracellular membrane-bounded organelle
GO:0005634	0.963	nucleus
GO:0016460	0.948	myosin II complex
GO:0005576	0.943	extracellular region
GO:0042641	0.922	actomyosin
GO:0001725	0.892	stress fiber
GO:0070062	0.855	extracellular exosome
GO:0099512	0.796	supramolecular fiber
GO:0120025	0.782	plasma membrane bounded cell projection
GO:0012505	0.762	endomembrane system
GO:0005938	0.704	cell cortex
GO:0030054	0.683	cell junction
GO:0031410	0.641	cytoplasmic vesicle
GO:0031974	0.622	membrane-enclosed lumen
GO:0031252	0.575	cell leading edge
GO:0070013	0.560	intracellular organelle lumen
GO:0031981	0.554	nuclear lumen
GO:0043292	0.549	contractile fiber
GO:0098862	0.469	cluster of actin-based cell projections
GO:0045202	0.453	synapse
GO:0005654	0.392	nucleoplasm
GO:0005903	0.388	brush border
GO:0030027	0.381	lamellipodium
GO:0043005	0.361	neuron projection
GO:0098590	0.352	plasma membrane region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	0.979	myosin ATPase.

[back to server]