StarFunc result for job id P35590

User Input

>input (1138 residues)
MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPP
LLLEKDDRIVRTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVH
NSPGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLL
QLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGPGCTKECPGCLHGGVCHDH
DGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRGLTFCLPDPYGCSCGSGWRGS
QCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASEL
EFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTV
RLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTT
DCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSP
QARTALLTGLTPGTHYQLDVQLYHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEI
QLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRA
SIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVSATCLTILAAL
LTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNI
INLLGACKNRGYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFA
SDAANGMQYLSEKQFIHRDLAARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWM
AIESLNYSVYTTKSDVWSFGVLLWEIVSLGGTPYCGMTCAELYEKLPQGYRMEQPRNCDD
EVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNMSLFENFTYAGIDATAEEA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O73791	0.288	0.293	0.000	1116	0.443	0.452	O73791.pdb.gz	TIE2_DANRE Tyrosine-protein kinase receptor Tie-2 OS=Danio rerio OX=7955 GN=tie2 PE=2 SV=1
2	AFDB:P35590	1.000	1.000	0.000	1138	1.000	1.000	P35590.pdb.gz	TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 OS=Homo sapiens OX=9606 GN=TIE1 PE=1 SV=1
3	AFDB:Q02763	0.435	0.440	0.000	1124	0.454	0.460	Q02763.pdb.gz	TIE2_HUMAN Angiopoietin-1 receptor OS=Homo sapiens OX=9606 GN=TEK PE=1 SV=2
4	AFDB:Q06418	0.237	0.300	4.793E-53	890	0.178	0.228	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
5	AFDB:P57097	0.251	0.284	1.226E-51	994	0.167	0.191	P57097.pdb.gz	MERTK_RAT Tyrosine-protein kinase Mer OS=Rattus norvegicus OX=10116 GN=Mertk PE=2 SV=1
6	AFDB:Q9YI66	0.254	0.325	4.437E-51	874	0.171	0.223	Q9YI66.pdb.gz	TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio OX=7955 GN=tyro3 PE=2 SV=1
7	AFDB:P30530	0.236	0.299	8.228E-51	894	0.181	0.230	P30530.pdb.gz	UFO_HUMAN Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL PE=1 SV=4
8	AFDB:P55144	0.236	0.302	1.606E-50	880	0.178	0.230	P55144.pdb.gz	TYRO3_MOUSE Tyrosine-protein kinase receptor TYRO3 OS=Mus musculus OX=10090 GN=Tyro3 PE=1 SV=2
9	AFDB:Q00993	0.252	0.311	4.495E-50	888	0.179	0.230	Q00993.pdb.gz	UFO_MOUSE Tyrosine-protein kinase receptor UFO OS=Mus musculus OX=10090 GN=Axl PE=1 SV=2
10	AFDB:Q12866	0.230	0.261	5.245E-50	999	0.170	0.194	Q12866.pdb.gz	MERTK_HUMAN Tyrosine-protein kinase Mer OS=Homo sapiens OX=9606 GN=MERTK PE=1 SV=2
11	PDB:1k9aB	0.214	0.540	7.126E-22	441	0.089	0.229	1k9aB.pdb.gz
12	PDB:2h8hA	0.212	0.520	2.482E-20	445	0.091	0.231	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
13	PDB:4fl2A	0.212	0.421	3.604E-19	555	0.085	0.175	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
14	PDB:1e07A	0.154	0.224	2.073E-18	642	0.083	0.146	1e07A.pdb.gz
15	PDB:4k2rA	0.216	0.435	1.994E-17	551	0.080	0.165	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:8dksA	0.188	0.690	6.266E-16	283	0.068	0.272	8dksA.pdb.gz	Bicyclic pyrimidine compounds as potent IRAK4 inhibitors.
17	PDB:5oj2B	0.135	0.190	1.288E-15	692	0.083	0.137	5oj2B.pdb.gz
18	PDB:5a42A	0.098	0.077	2.154E-15	1597	0.089	0.063	5a42A.pdb.gz
19	PDB:3pfqA	0.204	0.420	4.205E-15	523	0.070	0.153	3pfqA.pdb.gz	Crystal Structure and Allosteric Activation of Protein Kinase C beta II
20	PDB:2qkwB	0.205	0.733	6.029E-15	292	0.065	0.253	2qkwB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZW61	0.0	903	1121	0.462	0.469	A0A8I5ZW61_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tek PE=1 SV=1
2	A0A8I6G914	0.0	880	1069	0.453	0.482	A0A8I6G914_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tek PE=1 SV=1
3	B5DFD6	0.0	2169	1137	0.925	0.926	B5DFD6_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tie1 PE=2 SV=1
4	D3ZCD0	0.0	941	1120	0.471	0.479	D3ZCD0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Tek PE=4 SV=1
5	O73791	0.0	836	1116	0.433	0.442	TIE2_DANRE Tyrosine-protein kinase receptor Tie-2 OS=Danio rerio OX=7955 GN=tie2 PE=2 SV=1
6	P35590	0.0	2341	1138	1.000	1.000	TIE1_HUMAN Tyrosine-protein kinase receptor Tie-1 OS=Homo sapiens OX=9606 GN=TIE1 PE=1 SV=1
7	Q02763	0.0	950	1124	0.465	0.471	TIE2_HUMAN Angiopoietin-1 receptor OS=Homo sapiens OX=9606 GN=TEK PE=1 SV=2
8	Q02858	0.0	945	1122	0.467	0.473	TIE2_MOUSE Angiopoietin-1 receptor OS=Mus musculus OX=10090 GN=Tek PE=1 SV=2
9	Q06806	0.0	2142	1134	0.927	0.930	TIE1_MOUSE Tyrosine-protein kinase receptor Tie-1 OS=Mus musculus OX=10090 GN=Tie1 PE=1 SV=3
10	O73792	1.18e-117	363	184	0.149	0.918	TIE1_DANRE Tyrosine-protein kinase receptor Tie-1 (Fragment) OS=Danio rerio OX=7955 GN=tie1 PE=2 SV=1
11	G3V9H8	4.33e-73	266	1115	0.137	0.140	RET_RAT Proto-oncogene tyrosine-protein kinase receptor Ret OS=Rattus norvegicus OX=10116 GN=Ret PE=1 SV=1
12	P07949	1.91e-72	265	1114	0.139	0.142	RET_HUMAN Proto-oncogene tyrosine-protein kinase receptor Ret OS=Homo sapiens OX=9606 GN=RET PE=1 SV=3
13	P35546	3.07e-72	264	1115	0.128	0.131	RET_MOUSE Proto-oncogene tyrosine-protein kinase receptor Ret OS=Mus musculus OX=10090 GN=Ret PE=1 SV=2
14	A0A8I5Y7R6	4.43e-72	258	782	0.123	0.179	A0A8I5Y7R6_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=3 SV=1
15	F1LSN4	7.19e-72	258	801	0.123	0.175	F1LSN4_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=3
16	Q9JHX9	8.16e-72	258	800	0.123	0.175	Q9JHX9_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=2 SV=1
17	A0A0G2K210	8.26e-72	258	803	0.123	0.174	A0A0G2K210_RAT Fibroblast growth factor receptor OS=Rattus norvegicus OX=10116 GN=Fgfr3 PE=1 SV=2
18	P11362	9.82e-72	258	822	0.120	0.167	FGFR1_HUMAN Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3
19	P16092	1.08e-71	258	822	0.120	0.167	FGFR1_MOUSE Fibroblast growth factor receptor 1 OS=Mus musculus OX=10090 GN=Fgfr1 PE=1 SV=2
20	P22607	1.40e-71	257	806	0.123	0.174	FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FGFR3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05790 C2-set	1.8e+02	13.7	Immunoglobulin C2-set domain
2	PF15774 DUF4702	4.3e+02	11.2	Domain of unknown function (DUF4702)
3	PF16303 DUF4945	7e+02	11.7	Domain of unknown function (DUF4945)
4	PF07974 EGF_2	3.1	19.5	EGF-like domain
5	PF00041 fn3	1.4e-34	129.6	Fibronectin type III domain
6	PF12330 Haspin_kinase	3.5e+02	11.5	Haspin like kinase domain
7	PF12661 hEGF	4.2	19.4	Human growth factor-like EGF
8	PF07679 I-set	0.00089	30.6	Immunoglobulin I-set domain
9	PF00047 ig	1.8e-12	58.6	Immunoglobulin domain
10	PF13895 Ig_2	12	17.6	Immunoglobulin domain
11	PF13927 Ig_3	0.024	26.5	Immunoglobulin domain
12	PF00053 Laminin_EGF	6.3e+02	11.9	Laminin EGF domain
13	PF00069 Pkinase	1.7e-36	137.6	Protein kinase domain
14	PF17667 Pkinase_fungal	1.7e+02	12.4	Fungal protein kinase
15	PF07714 PK_Tyr_Ser-Thr	9.7e-88	305.4	Protein tyrosine and serine/threonine kinase
16	PF16656 Pur_ac_phosph_N	0.082	24.9	Purple acid Phosphatase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361554

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000314897	0.972	Angiopoietin-2
2	9606.ENSP00000371347	0.890	Angiopoietin-4
3	9606.ENSP00000428340	0.885	Angiopoietin-1
4	9606.ENSP00000362524	0.796	Angiopoietin-related protein 2
5	9606.ENSP00000344115	0.731	Cadherin-5
6	9606.ENSP00000301455	0.721	Angiopoietin-related protein 4
7	9606.ENSP00000457421	0.702	Platelet endothelial cell adhesion molecule
8	9606.ENSP00000478570	0.699	Vascular endothelial growth factor A
9	9606.ENSP00000360170	0.676	Angiopoietin-related protein 3
10	9606.ENSP00000261405	0.659	Von Willebrand factor
11	9606.ENSP00000296641	0.651	Proteinase-activated receptor 3
12	9606.ENSP00000334928	0.634	Receptor-type tyrosine-protein phosphatase beta
13	9606.ENSP00000234816	0.610	Angiopoietin-related protein 1
14	9606.ENSP00000304945	0.578	Roundabout homolog 4
15	9606.ENSP00000321326	0.568	Proteinase-activated receptor 1
16	9606.ENSP00000279281	0.562	Vacuolar protein sorting-associated protein 51 homolog
17	9606.ENSP00000340944	0.552	Tyrosine-protein phosphatase non-receptor type 11
18	9606.ENSP00000253109	0.550	Angiopoietin-related protein 6
19	9606.ENSP00000264498	0.548	Fibroblast growth factor 2
20	9606.ENSP00000480043	0.537	Vascular endothelial growth factor C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0044877	0.414	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.995	multicellular organismal process
GO:0009987	0.993	cellular process
GO:0050896	0.986	response to stimulus
GO:0050794	0.986	regulation of cellular process
GO:0048856	0.977	anatomical structure development
GO:0007275	0.973	multicellular organism development
GO:0051716	0.965	cellular response to stimulus
GO:0048731	0.957	system development
GO:0009653	0.945	anatomical structure morphogenesis
GO:0030154	0.919	cell differentiation
GO:0023052	0.912	signaling
GO:0035295	0.911	tube development
GO:0072359	0.906	circulatory system development
GO:0007154	0.901	cell communication
GO:0035239	0.890	tube morphogenesis
GO:0007165	0.842	signal transduction
GO:0001568	0.811	blood vessel development
GO:0048522	0.629	positive regulation of cellular process
GO:0051239	0.501	regulation of multicellular organismal process
GO:0048519	0.467	negative regulation of biological process
GO:0019222	0.428	regulation of metabolic process
GO:0048583	0.417	regulation of response to stimulus
GO:0030334	0.388	regulation of cell migration
GO:0007166	0.367	cell surface receptor signaling pathway
GO:0060255	0.362	regulation of macromolecule metabolic process
GO:0009893	0.362	positive regulation of metabolic process
GO:0080090	0.353	regulation of primary metabolic process
GO:0048523	0.344	negative regulation of cellular process
GO:0008152	0.335	metabolic process
GO:0051171	0.330	regulation of nitrogen compound metabolic process
GO:2000147	0.329	positive regulation of cell motility
GO:0050793	0.320	regulation of developmental process
GO:0009888	0.320	tissue development
GO:0031323	0.318	regulation of cellular metabolic process
GO:0042127	0.317	regulation of cell population proliferation
GO:0030335	0.317	positive regulation of cell migration

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.585	intracellular anatomical structure
GO:0005737	0.536	cytoplasm
GO:0043226	0.335	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]