StarFunc result for job id P35611

User Input

>input (737 residues)
MNGDSRAAVVTSPPPTTAPHKERYFDRVDENNPEYLRERNMAPDLRQDFNMMEQKKRVSM
ILQSPAFCEELESMIQEQFKKGKNPTGLLALQQIADFMTTNVPNVYPAAPQGGMAALNMS
LGMVTPVNDLRGSDSIAYDKGEKLLRCKLAAFYRLADLFGWSQLIYNHITTRVNSEQEHF
LIVPFGLLYSEVTASSLVKINLQGDIVDRGSTNLGVNQAGFTLHSAIYAARPDVKCVVHI
HTPAGAAVSAMKCGLLPISPEALSLGEVAYHDYHGILVDEEEKVLIQKNLGPKSKVLILR
NHGLVSVGESVEEAFYYIHNLVVACEIQVRTLASAGGPDNLVLLNPEKYKAKSRSPGSPV
GEGTGSPPKWQIGEQEFEALMRMLDNLGYRTGYPYRYPALREKSKKYSDVEVPASVTGYS
FASDGDSGTCSPLRHSFQKQQREKTRWLNSGRGDEASEEGQNGSSPKSKTKWTKEDGHRT
STSAVPNLFVPLNTNPKEVQEMRNKIREQNLQDIKTAGPQSQVLCGVVMDRSLVQGELVT
ASKAIIEKEYQPHVIVSTTGPNPFTTLTDRELEEYRREVERKQKGSEENLDEAREQKEKS
PPDQPAVPHPPPSTPIKLEEDLVPEPTTGDDSDAATFKPTLPDLSPDEPSEALGFPMLEK
EEEAHRPPSPTEAPTEASPEPAPDPAPVAEEAAPSAVEEGAAADPGSDGSPGKSPSKKKK
KFRTPSFLKKSKKKSDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35611	1.000	1.000	0.000	737	1.000	1.000	P35611.pdb.gz	ADDA_HUMAN Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2
2	AFDB:Q02645	0.379	0.247	1.644E-42	1156	0.346	0.221	Q02645.pdb.gz	HTS_DROME Protein hu-li tai shao OS=Drosophila melanogaster OX=7227 GN=hts PE=1 SV=2
3	AFDB:Q54T47	0.325	0.868	2.869E-27	268	0.149	0.410	Q54T47.pdb.gz	Q54T47_DICDI Alpha adducin OS=Dictyostelium discoideum OX=44689 GN=ahhA PE=4 SV=1
4	PDB:2z7bA	0.273	0.779	6.165E-13	237	0.077	0.241	2z7bA.pdb.gz	Gene Identification and Structural Characterization of the Pyridoxal 5'-Phosphate Degradative Protein 3-Hydroxy-2-methylpyridine-4,5-dicarboxylate Decarboxylase from Mesorhizobium loti MAFF303099
5	PDB:2fuaA	0.240	0.770	2.259E-11	210	0.069	0.243	2fuaA.pdb.gz	Refined high-resolution structure of the metal-ion dependent L-fuculose-1-phosphate aldolase (class II) from Escherichia coli.
6	PDB:1jdiA	0.240	0.713	2.353E-10	223	0.054	0.179	1jdiA.pdb.gz	The structure of L-ribulose-5-phosphate 4-epimerase: an aldolase-like platform for epimerization.
7	PDB:1gt7A	0.224	0.551	1.591E-7	274	0.054	0.146	1gt7A.pdb.gz	The Structure of L-Rhamnulose-1-Phosphate Aldolase (Class II) Solved by Low-Resolution Sir Phasing and 20-Fold Ncs Averaging
8	PDB:4m6rA	0.231	0.679	1.999E-7	224	0.046	0.152	4m6rA.pdb.gz	Structural and biochemical basis for the inhibition of cell death by APIP, a methionine salvage enzyme.
9	AFDB:B5DFK6	0.050	0.033	3.646E-3	1204	0.094	0.057	B5DFK6.pdb.gz	B5DFK6_RAT Adaptor related protein complex 3 subunit delta 1 OS=Rattus norvegicus OX=10116 GN=Ap3d1 PE=1 SV=1
10	AFDB:O77033	0.039	0.030	1.612E-2	1390	0.080	0.042	O77033.pdb.gz	CYC8_DICDI General transcriptional corepressor trfA OS=Dictyostelium discoideum OX=44689 GN=trfA PE=2 SV=1
11	AFDB:M0QZI3	0.046	0.040	1.706E-2	896	0.085	0.070	M0QZI3.pdb.gz
12	AFDB:Q9VQ58	0.043	0.040	5.055E-2	1023	0.102	0.073	Q9VQ58.pdb.gz	Q9VQ58_DROME FI15207p1 OS=Drosophila melanogaster OX=7227 GN=EMSY PE=1 SV=1
13	AFDB:Q57W52	0.082	0.070	8.456E-2	915	0.111	0.090	Q57W52.pdb.gz	Q57W52_TRYB2 OTU domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.190 PE=4 SV=1
14	AFDB:Q8K0L9	0.053	0.053	8.953E-2	741	0.072	0.072	Q8K0L9.pdb.gz	ZBT20_MOUSE Zinc finger and BTB domain-containing protein 20 OS=Mus musculus OX=10090 GN=Zbtb20 PE=1 SV=1
15	AFDB:O35274	0.052	0.047	9.480E-2	817	0.084	0.076	O35274.pdb.gz	NEB2_RAT Neurabin-2 OS=Rattus norvegicus OX=10116 GN=Ppp1r9b PE=1 SV=1
16	PDB:6ov2A	0.058	0.144	2.865E-1	182	0.034	0.137	6ov2A.pdb.gz
17	PDB:2h3pA	0.061	0.071	4.793E-1	599	0.045	0.055	2h3pA.pdb.gz	Crystal structures of murine carnitine acetyltransferase in ternary complexes with its substrates
18	PDB:5b2gC	0.059	0.094	8.988E-1	350	0.037	0.077	5b2gC.pdb.gz
19	PDB:7jsnA	0.066	0.061	1.785	820	0.022	0.020	7jsnA.pdb.gz	Structure of the Visual Signaling Complex between Transducin and Phosphodiesterase 6.
20	PDB:7ocaI	0.066	0.183	2.119	185	0.047	0.189	7ocaI.pdb.gz	Gating and modulation of a hetero-octameric AMPA glutamate receptor.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Q5P5	0.0	619	678	0.441	0.479	A0A2R8Q5P5_DANRE Adducin 3 (gamma) a OS=Danio rerio OX=7955 GN=add3 PE=1 SV=1
2	A0A2R8QBF8	0.0	618	671	0.433	0.475	A0A2R8QBF8_DANRE Adducin 3 (gamma) a OS=Danio rerio OX=7955 GN=add3 PE=1 SV=1
3	H0Y9H2	0.0	825	444	0.559	0.928	H0Y9H2_HUMAN Adducin 1 (Fragment) OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=1
4	P35611	0.0	1520	737	1.000	1.000	ADDA_HUMAN Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2
5	P35612	0.0	613	726	0.426	0.433	ADDB_HUMAN Beta-adducin OS=Homo sapiens OX=9606 GN=ADD2 PE=1 SV=3
6	Q05764	0.0	623	725	0.427	0.434	ADDB_RAT Beta-adducin OS=Rattus norvegicus OX=10116 GN=Add2 PE=1 SV=4
7	Q1LUP1	0.0	617	672	0.437	0.479	Q1LUP1_DANRE Adducin 3 (gamma) a OS=Danio rerio OX=7955 GN=add3 PE=1 SV=1
8	Q1LUP2	0.0	617	645	0.427	0.488	Q1LUP2_DANRE Adducin 3 (gamma) a OS=Danio rerio OX=7955 GN=add3 PE=1 SV=1
9	Q5VU08	0.0	685	706	0.472	0.493	Q5VU08_HUMAN Adducin 3 (Gamma), isoform CRA_a OS=Homo sapiens OX=9606 GN=ADD3 PE=2 SV=1
10	Q62847	0.0	680	705	0.471	0.492	ADDG_RAT Gamma-adducin OS=Rattus norvegicus OX=10116 GN=Add3 PE=1 SV=3
11	Q63028	0.0	1352	735	0.921	0.924	ADDA_RAT Alpha-adducin OS=Rattus norvegicus OX=10116 GN=Add1 PE=1 SV=2
12	Q7ZUA1	0.0	616	672	0.412	0.452	Q7ZUA1_DANRE Add3a protein OS=Danio rerio OX=7955 GN=zgc:55992 PE=1 SV=1
13	Q96D30	0.0	820	400	0.531	0.978	Q96D30_HUMAN ADD1 protein OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=1
14	Q9QYB5	0.0	650	706	0.467	0.487	ADDG_MOUSE Gamma-adducin OS=Mus musculus OX=10090 GN=Add3 PE=1 SV=2
15	Q9QYB8	0.0	622	725	0.427	0.434	ADDB_MOUSE Beta-adducin OS=Mus musculus OX=10090 GN=Add2 PE=1 SV=4
16	Q9QYC0	0.0	1368	735	0.927	0.929	ADDA_MOUSE Alpha-adducin OS=Mus musculus OX=10090 GN=Add1 PE=1 SV=2
17	Q9UEY8	0.0	685	706	0.472	0.493	ADDG_HUMAN Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1
18	Q02645	1.23e-122	396	1156	0.316	0.202	HTS_DROME Protein hu-li tai shao OS=Drosophila melanogaster OX=7227 GN=hts PE=1 SV=2
19	Q9U9K0	1.15e-119	377	732	0.315	0.317	ADD1_CAEEL Adducin-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=add-1 PE=2 SV=2
20	G8JYB0	2.40e-119	376	718	0.315	0.323	G8JYB0_CAEEL Class II aldolase/adducin N-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=add-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00596 Aldolase_II	2.6e-36	136.7	Class II Aldolase and Adducin N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264758

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264436	0.948	Beta-adducin
2	9606.ENSP00000311032	0.922	Caspase-3
3	9606.ENSP00000348381	0.921	Gamma-adducin
4	9606.ENSP00000216037	0.900	X-box-binding protein 1
5	9606.ENSP00000427866	0.876	Dematin
6	9606.ENSP00000290866	0.848	Angiotensin-converting enzyme
7	9606.ENSP00000376800	0.824	Myotrophin
8	9606.ENSP00000348069	0.773	Sterol regulatory element-binding protein 1
9	9606.ENSP00000263867	0.739	Macrophage-capping protein
10	9606.ENSP00000229264	0.719	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
11	9606.ENSP00000361824	0.716	Spectrin alpha chain, non-erythrocytic 1
12	9606.ENSP00000468354	0.695	Ankyrin repeat domain-containing protein 29
13	9606.ENSP00000362576	0.675	Tyrosine--tRNA ligase, cytoplasmic
14	9606.ENSP00000355889	0.666	Isoleucine--tRNA ligase, mitochondrial
15	9606.ENSP00000349259	0.663	Spectrin beta chain, non-erythrocytic 1
16	9606.ENSP00000325822	0.662	Cytochrome P450 11B2, mitochondrial
17	9606.ENSP00000369897	0.654	Cysteine--tRNA ligase, cytoplasmic
18	9606.ENSP00000401010	0.650	F-actin-capping protein subunit beta
19	9606.ENSP00000408576	0.647	Probable leucine--tRNA ligase, mitochondrial
20	9606.ENSP00000387760	0.636	Angiotensin-converting enzyme

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	1.000	protein-containing complex binding
GO:0005515	1.000	protein binding
GO:0008092	0.974	cytoskeletal protein binding
GO:0097159	0.953	organic cyclic compound binding
GO:1901363	0.947	heterocyclic compound binding
GO:0042802	0.947	identical protein binding
GO:0003779	0.946	actin binding
GO:0046983	0.913	protein dimerization activity
GO:0051015	0.895	actin filament binding
GO:0042803	0.891	protein homodimerization activity
GO:0003676	0.889	nucleic acid binding
GO:0005200	0.885	structural constituent of cytoskeleton
GO:0030507	0.852	spectrin binding
GO:0003723	0.851	RNA binding
GO:0050839	0.845	cell adhesion molecule binding
GO:0046982	0.845	protein heterodimerization activity
GO:0045296	0.837	cadherin binding
GO:0140297	0.833	DNA-binding transcription factor binding
GO:0061629	0.782	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003824	0.596	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.991	biological regulation
GO:0009987	0.989	cellular process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.961	regulation of cellular process
GO:0051128	0.914	regulation of cellular component organization
GO:0050896	0.904	response to stimulus
GO:0051239	0.901	regulation of multicellular organismal process
GO:0051716	0.884	cellular response to stimulus
GO:0050793	0.884	regulation of developmental process
GO:0016043	0.879	cellular component organization
GO:0048518	0.873	positive regulation of biological process
GO:0048522	0.856	positive regulation of cellular process
GO:0090066	0.855	regulation of anatomical structure size
GO:0033043	0.796	regulation of organelle organization
GO:1901700	0.767	response to oxygen-containing compound
GO:0010033	0.668	response to organic substance
GO:0051493	0.637	regulation of cytoskeleton organization
GO:0032535	0.604	regulation of cellular component size
GO:0051094	0.589	positive regulation of developmental process
GO:0032501	0.525	multicellular organismal process
GO:0070887	0.525	cellular response to chemical stimulus
GO:0008152	0.506	metabolic process
GO:0032502	0.352	developmental process
GO:0044237	0.351	cellular metabolic process
GO:0071704	0.339	organic substance metabolic process
GO:0048856	0.336	anatomical structure development
GO:0048523	0.335	negative regulation of cellular process
GO:0044238	0.315	primary metabolic process
GO:0051130	0.306	positive regulation of cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0043229	0.998	intracellular organelle
GO:0031981	0.993	nuclear lumen
GO:0005829	0.990	cytosol
GO:0005856	0.987	cytoskeleton
GO:0005886	0.985	plasma membrane
GO:0030054	0.983	cell junction
GO:0005654	0.983	nucleoplasm
GO:0070161	0.843	anchoring junction
GO:0005912	0.808	adherens junction
GO:0032991	0.683	protein-containing complex
GO:0015629	0.453	actin cytoskeleton
GO:0008290	0.378	F-actin capping protein complex
GO:0012505	0.375	endomembrane system
GO:0045202	0.351	synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]