StarFunc result for job id P35625

User Input

>input (211 residues)
MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKKLVKEGPFGTL
VYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNF
VERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSK
HYACIRQKGGYCSWYRGWAPPDKSIINATDP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P35625	1.000	1.000	7.780E-48	211	1.000	1.000	P35625.pdb.gz	TIMP3_HUMAN Metalloproteinase inhibitor 3 OS=Homo sapiens OX=9606 GN=TIMP3 PE=1 SV=2
2	AFDB:P81556	0.811	0.766	1.958E-27	224	0.436	0.411	P81556.pdb.gz	TIMP4_RAT Metalloproteinase inhibitor 4 OS=Rattus norvegicus OX=10116 GN=Timp4 PE=2 SV=2
3	AFDB:Q1MTE8	0.817	0.785	3.619E-26	220	0.427	0.409	Q1MTE8.pdb.gz
4	AFDB:Q64HW8	0.823	0.790	4.087E-26	220	0.436	0.418	Q64HW8.pdb.gz	Q64HW8_ONCMY TIMP metallopeptidase inhibitor 2b OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
5	AFDB:P16035	0.812	0.781	6.646E-26	220	0.427	0.409	P16035.pdb.gz	TIMP2_HUMAN Metalloproteinase inhibitor 2 OS=Homo sapiens OX=9606 GN=TIMP2 PE=1 SV=2
6	AFDB:P01033	0.774	0.788	1.037E-22	207	0.365	0.372	P01033.pdb.gz	TIMP1_HUMAN Metalloproteinase inhibitor 1 OS=Homo sapiens OX=9606 GN=TIMP1 PE=1 SV=1
7	AFDB:A0A2R8Q0U9	0.799	0.740	8.190E-22	229	0.360	0.332	A0A2R8Q0U9.pdb.gz	A0A2R8Q0U9_DANRE Metalloproteinase inhibitor 2-like OS=Danio rerio OX=7955 GN=timp4.1 PE=3 SV=1
8	PDB:1gxdC	0.776	0.849	9.307E-22	192	0.408	0.448	1gxdC.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
9	AFDB:P30120	0.782	0.762	3.313E-21	217	0.327	0.318	P30120.pdb.gz	TIMP1_RAT Metalloproteinase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Timp1 PE=1 SV=2
10	AFDB:P12032	0.780	0.801	3.976E-21	205	0.318	0.327	P12032.pdb.gz	TIMP1_MOUSE Metalloproteinase inhibitor 1 OS=Mus musculus OX=10090 GN=Timp1 PE=1 SV=2
11	PDB:1ueaB	0.742	0.855	5.422E-21	181	0.332	0.387	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
12	AFDB:Q9VH14	0.688	0.691	8.074E-15	210	0.199	0.200	Q9VH14.pdb.gz	TIMP_DROME Tissue inhibitor of metalloproteinase OS=Drosophila melanogaster OX=7227 GN=Timp PE=1 SV=1
13	PDB:8d0bA	0.267	0.061	1.717E-2	1116	0.071	0.013	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
14	PDB:4owwB	0.253	0.429	3.350E-2	107	0.071	0.140	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
15	PDB:6gejY	0.092	0.059	1.000E-1	447	0.090	0.043	6gejY.pdb.gz	Structure and dynamics of the yeast SWR1-nucleosome complex.
16	PDB:7u5cE	0.279	0.061	1.837E-1	1147	0.076	0.014	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
17	PDB:2pi2A	0.234	0.356	2.074E-1	129	0.052	0.085	2pi2A.pdb.gz
18	PDB:3k8aB	0.198	0.354	2.074E-1	103	0.047	0.097	3k8aB.pdb.gz
19	PDB:1nnxA	0.223	0.409	2.204E-1	93	0.047	0.108	1nnxA.pdb.gz
20	PDB:6w6wC	0.221	0.157	2.342E-1	323	0.062	0.040	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P35625	5.64e-160	442	211	1.000	1.000	TIMP3_HUMAN Metalloproteinase inhibitor 3 OS=Homo sapiens OX=9606 GN=TIMP3 PE=1 SV=2
2	P39876	2.89e-154	427	211	0.962	0.962	TIMP3_MOUSE Metalloproteinase inhibitor 3 OS=Mus musculus OX=10090 GN=Timp3 PE=1 SV=1
3	P48032	9.68e-153	423	211	0.953	0.953	TIMP3_RAT Metalloproteinase inhibitor 3 OS=Rattus norvegicus OX=10116 GN=Timp3 PE=2 SV=1
4	P25785	7.42e-64	199	220	0.427	0.409	TIMP2_MOUSE Metalloproteinase inhibitor 2 OS=Mus musculus OX=10090 GN=Timp2 PE=1 SV=2
5	P30121	7.84e-64	199	220	0.427	0.409	TIMP2_RAT Metalloproteinase inhibitor 2 OS=Rattus norvegicus OX=10116 GN=Timp2 PE=1 SV=3
6	Q64HW8	1.85e-63	197	220	0.455	0.436	Q64HW8_ONCMY TIMP metallopeptidase inhibitor 2b OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	P16035	2.84e-63	197	220	0.427	0.409	TIMP2_HUMAN Metalloproteinase inhibitor 2 OS=Homo sapiens OX=9606 GN=TIMP2 PE=1 SV=2
8	Q7SZM6	1.95e-62	195	220	0.450	0.432	Q7SZM6_DANRE Metalloproteinase inhibitor 2 precursor OS=Danio rerio OX=7955 GN=etID32613.12 PE=2 SV=1
9	Q9JHB3	2.10e-61	192	224	0.436	0.411	TIMP4_MOUSE Metalloproteinase inhibitor 4 OS=Mus musculus OX=10090 GN=Timp4 PE=2 SV=1
10	P81556	2.36e-60	190	224	0.431	0.406	TIMP4_RAT Metalloproteinase inhibitor 4 OS=Rattus norvegicus OX=10116 GN=Timp4 PE=2 SV=2
11	A0A2R8Q0U9	1.30e-46	155	229	0.351	0.323	A0A2R8Q0U9_DANRE Metalloproteinase inhibitor 2-like OS=Danio rerio OX=7955 GN=timp4.1 PE=3 SV=1
12	P01033	2.94e-43	146	207	0.370	0.377	TIMP1_HUMAN Metalloproteinase inhibitor 1 OS=Homo sapiens OX=9606 GN=TIMP1 PE=1 SV=1
13	P12032	7.09e-38	132	205	0.322	0.332	TIMP1_MOUSE Metalloproteinase inhibitor 1 OS=Mus musculus OX=10090 GN=Timp1 PE=1 SV=2
14	P30120	1.32e-36	129	217	0.318	0.309	TIMP1_RAT Metalloproteinase inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Timp1 PE=1 SV=2
15	Q9VH14	1.24e-12	66.2	210	0.175	0.176	TIMP_DROME Tissue inhibitor of metalloproteinase OS=Drosophila melanogaster OX=7227 GN=Timp PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00965 TIMP	1.2e-63	225.8	Tissue inhibitor of metalloproteinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010384409.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010373286.1	0.976	Matrix metallopeptidase 2
2	61622.XP_010377986.1	0.944	Disintegrin and metalloproteinase domain-containing protein 17 isoform X1
3	61622.XP_010382490.1	0.836	Matrix metalloproteinase-9
4	61622.XP_010377365.1	0.804	Matrix metallopeptidase 3
5	61622.XP_010377364.1	0.798	Matrix metallopeptidase 1
6	61622.XP_010376658.1	0.784	Matrix metallopeptidase 14
7	61622.XP_010374525.1	0.767	EGF containing fibulin like extracellular matrix protein 1
8	61622.XP_010361178.1	0.762	Kinase insert domain receptor
9	61622.XP_010363813.1	0.762	Matrix metallopeptidase 15
10	61622.XP_010360689.1	0.759	Acts as a tumor suppressor in many tumor types
11	61622.XP_010377368.1	0.745	Matrix metallopeptidase 13
12	61622.XP_010369997.1	0.744	Matrix metalloproteinase-16
13	61622.XP_010377360.1	0.744	Matrix metallopeptidase 7
14	61622.XP_010381827.1	0.744	Hemopexin
15	61622.XP_010377363.1	0.740	Matrix metallopeptidase 10
16	61622.XP_010377372.1	0.740	Matrix metallopeptidase 8
17	61622.XP_010376868.1	0.736	Matrix metallopeptidase 17
18	61622.XP_010374427.1	0.735	Matrix metalloproteinase-25
19	61622.XP_010384831.1	0.731	Matrix metalloproteinase-24
20	61622.XP_010387314.1	0.727	Prolow-density lipoprotein receptor-related protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008191	1.000	metalloendopeptidase inhibitor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050896	0.990	response to stimulus
GO:0050794	0.990	regulation of cellular process
GO:0045861	0.988	negative regulation of proteolysis
GO:0009987	0.983	cellular process
GO:0048523	0.957	negative regulation of cellular process
GO:0051716	0.949	cellular response to stimulus
GO:0042221	0.943	response to chemical
GO:0051336	0.940	regulation of hydrolase activity
GO:0044092	0.935	negative regulation of molecular function
GO:0010033	0.902	response to organic substance
GO:0048522	0.884	positive regulation of cellular process
GO:0070887	0.883	cellular response to chemical stimulus
GO:0032501	0.817	multicellular organismal process
GO:0043408	0.812	regulation of MAPK cascade
GO:0052547	0.808	regulation of peptidase activity
GO:0043086	0.806	negative regulation of catalytic activity
GO:0071310	0.805	cellular response to organic substance
GO:0032502	0.798	developmental process
GO:0048856	0.772	anatomical structure development
GO:0052548	0.763	regulation of endopeptidase activity
GO:0031323	0.762	regulation of cellular metabolic process
GO:0010951	0.745	negative regulation of endopeptidase activity
GO:0048584	0.731	positive regulation of response to stimulus
GO:0043067	0.719	regulation of programmed cell death
GO:0042981	0.709	regulation of apoptotic process
GO:0042127	0.705	regulation of cell population proliferation
GO:0007275	0.668	multicellular organism development
GO:0009894	0.633	regulation of catabolic process
GO:2001233	0.632	regulation of apoptotic signaling pathway
GO:0031324	0.607	negative regulation of cellular metabolic process
GO:0023056	0.529	positive regulation of signaling
GO:0010647	0.529	positive regulation of cell communication
GO:0009967	0.523	positive regulation of signal transduction
GO:0048585	0.498	negative regulation of response to stimulus
GO:2001236	0.490	regulation of extrinsic apoptotic signaling pathway
GO:0009895	0.468	negative regulation of catabolic process
GO:0009893	0.450	positive regulation of metabolic process
GO:0010604	0.443	positive regulation of macromolecule metabolic process
GO:0051173	0.386	positive regulation of nitrogen compound metabolic process
GO:0009968	0.382	negative regulation of signal transduction
GO:0010468	0.344	regulation of gene expression
GO:0008152	0.328	metabolic process
GO:0048731	0.327	system development
GO:0006950	0.311	response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.998	cell periphery
GO:0005622	0.998	intracellular anatomical structure
GO:0070013	0.988	intracellular organelle lumen
GO:0012505	0.985	endomembrane system
GO:0062023	0.977	collagen-containing extracellular matrix
GO:0005737	0.971	cytoplasm
GO:0043231	0.969	intracellular membrane-bounded organelle
GO:0005615	0.920	extracellular space
GO:0031982	0.900	vesicle
GO:0031410	0.750	cytoplasmic vesicle
GO:0099503	0.502	secretory vesicle
GO:0030141	0.471	secretory granule
GO:0060205	0.462	cytoplasmic vesicle lumen
GO:0034774	0.453	secretory granule lumen
GO:0031981	0.399	nuclear lumen
GO:0016020	0.349	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]