StarFunc result for job id P35637

User Input

>input (526 residues)
MASNDYTQQATQSYGAYPTQPGQGYSQQSSQPYGQQSYSGYSQSTDTSGYGQSSYSSYGQ
SQNTGYGTQSTPQGYGSTGGYGSSQSSQSSYGQQSSYPGYGQQPAPSSTSGSYGSSSQSS
SYGQPQSGSYSQQPSYGGQQQSYGQQQSYNPPQGYGQQNQYNSSSGGGGGGGGGGNYGQD
QSSMSSGGGSGGGYGNQDQSGGGGSGGYGQQDRGGRGRGGSGGGGGGGGGGYNRSSGGYE
PRGRGGGRGGRGGMGGSDRGGFNKFGGPRDQGSRHDSEQDNSDNNTIFVQGLGENVTIES
VADYFKQIGIIKTNKKTGQPMINLYTDRETGKLKGEATVSFDDPPSAKAAIDWFDGKEFS
GNPIKVSFATRRADFNRGGGNGRGGRGRGGPMGRGGYGGGGSGGGGRGGFPSGGGGGGGQ
QRAGDWKCPNPTCENMNFSWRNECNQCKAPKPDGPGGGPGGSHMGGNYGDDRRGGRGGYD
RGGYRGRGGDRGGFRGGRGGGDRGGFGPGKMDSRGEHRQDRRERPY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:H3BPE7	0.305	0.304	9.880E-72	527	0.998	0.996	H3BPE7.pdb.gz	H3BPE7_HUMAN FUS RNA binding protein OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1
2	AFDB:Q94KD0	0.165	0.202	2.972E-12	422	0.215	0.268	Q94KD0.pdb.gz	TA15B_ARATH Transcription initiation factor TFIID subunit 15b OS=Arabidopsis thaliana OX=3702 GN=TAF15B PE=1 SV=1
3	AFDB:A8E544	0.085	0.096	4.964E-10	436	0.365	0.440	A8E544.pdb.gz
4	PDB:7evoD	0.165	0.423	2.727E-8	200	0.046	0.120	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
5	PDB:7dvqY	0.153	0.551	3.312E-8	140	0.053	0.200	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
6	PDB:5xjcw	0.149	0.796	3.534E-8	91	0.057	0.330	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
7	PDB:5yzg1	0.143	0.303	1.673E-7	243	0.051	0.111	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
8	PDB:6qx91K	0.151	0.375	6.958E-7	201	0.048	0.124	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
9	PDB:5gm6V	0.142	0.558	8.451E-7	128	0.038	0.156	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
10	PDB:6y53o	0.144	0.458	8.451E-7	160	0.046	0.150	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
11	PDB:6g90B	0.150	0.392	9.620E-7	193	0.051	0.140	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
12	PDB:3lqvB	0.152	0.646	1.026E-6	115	0.042	0.191	3lqvB.pdb.gz	Branch Recognition by SF3b14
13	PDB:1hl6A	0.143	0.593	1.168E-6	119	0.048	0.210	1hl6A.pdb.gz
14	AFDB:Q9P789	0.140	0.073	3.120E-6	1065	0.124	0.061	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
15	AFDB:H7C269	0.156	0.095	1.216E-5	906	0.141	0.082	H7C269.pdb.gz	H7C269_HUMAN Trinucleotide repeat containing adaptor 6A (Fragment) OS=Homo sapiens OX=9606 GN=TNRC6A PE=1 SV=1
16	AFDB:P78332	0.129	0.064	1.100E-4	1123	0.131	0.061	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
17	AFDB:Q9VJ12	0.133	0.096	4.289E-4	739	0.133	0.095	Q9VJ12.pdb.gz	Q9VJ12_DROME Acinus, isoform A OS=Drosophila melanogaster OX=7227 GN=Acn PE=1 SV=1
18	AFDB:A0A0G2K3Y6	0.120	0.089	2.995E-3	729	0.116	0.084	A0A0G2K3Y6.pdb.gz	A0A0G2K3Y6_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
19	AFDB:Q9Y2K5	0.119	0.071	9.011E-3	976	0.135	0.073	Q9Y2K5.pdb.gz	R3HD2_HUMAN R3H domain-containing protein 2 OS=Homo sapiens OX=9606 GN=R3HDM2 PE=1 SV=3
20	AFDB:Q7Z2C9	0.068	0.054	2.092E-2	720	0.144	0.106	Q7Z2C9.pdb.gz	Q7Z2C9_DROME Nopp140-like nucleolar protein OS=Drosophila melanogaster OX=7227 GN=Nopp140 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H3BPE7	0.0	963	527	1.000	0.998	H3BPE7_HUMAN FUS RNA binding protein OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1
2	P35637	0.0	965	526	1.000	1.000	FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1
3	Q6IBQ5	0.0	965	526	1.000	1.000	Q6IBQ5_HUMAN FUS protein OS=Homo sapiens OX=9606 GN=FUS PE=2 SV=1
4	P56959	8.64e-108	333	518	0.473	0.481	FUS_MOUSE RNA-binding protein FUS OS=Mus musculus OX=10090 GN=Fus PE=1 SV=1
5	Q5PQK2	6.52e-107	331	518	0.471	0.479	Q5PQK2_RAT FUS RNA binding protein OS=Rattus norvegicus OX=10116 GN=Fus PE=3 SV=1
6	Q6J4Y8	8.54e-102	317	504	0.344	0.359	Q6J4Y8_CHICK FUS/TLS OS=Gallus gallus OX=9031 PE=1 SV=1
7	F1R0M4	2.09e-81	265	541	0.333	0.323	F1R0M4_DANRE FUS RNA-binding protein OS=Danio rerio OX=7955 GN=zgc:56390 PE=1 SV=1
8	Q92804	1.26e-78	259	592	0.426	0.378	RBP56_HUMAN TATA-binding protein-associated factor 2N OS=Homo sapiens OX=9606 GN=TAF15 PE=1 SV=1
9	Q3TLE4	1.98e-78	257	518	0.407	0.413	Q3TLE4_MOUSE TATA-binding protein-associated factor 2N OS=Mus musculus OX=10090 GN=Taf15 PE=2 SV=1
10	Q8BQ46	4.24e-78	257	557	0.407	0.384	Q8BQ46_MOUSE TAF15 RNA polymerase II, TATA box binding protein (TBP)-associated factor OS=Mus musculus OX=10090 GN=Taf15 PE=1 SV=1
11	B0QYK0	5.81e-74	248	618	0.409	0.348	B0QYK0_HUMAN EWS RNA binding protein 1 OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1
12	A0A0G2K850	3.61e-72	243	618	0.401	0.341	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
13	F6QCI0	3.98e-68	224	324	0.247	0.401	F6QCI0_MOUSE TATA-box binding protein associated factor 15 (Fragment) OS=Mus musculus OX=10090 GN=Taf15 PE=1 SV=1
14	Q01844	9.33e-62	216	656	0.217	0.174	EWS_HUMAN RNA-binding protein EWS OS=Homo sapiens OX=9606 GN=EWSR1 PE=1 SV=1
15	Q61545	4.04e-60	211	655	0.213	0.171	EWS_MOUSE RNA-binding protein EWS OS=Mus musculus OX=10090 GN=Ewsr1 PE=1 SV=2
16	A0A140UHY3	2.33e-59	209	661	0.209	0.166	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
17	B1WC50	2.41e-59	209	655	0.209	0.168	B1WC50_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
18	A0A8J8Y9N6	1.58e-56	202	654	0.205	0.165	A0A8J8Y9N6_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=1
19	Q4KM41	7.05e-56	191	317	0.200	0.331	Q4KM41_RAT Ewing sarcoma breakpoint region 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=2 SV=1
20	Q4QRG0	4.16e-50	182	579	0.198	0.180	Q4QRG0_DANRE EWS RNA-binding protein 1b OS=Danio rerio OX=7955 GN=fb40b11 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	1.9e-07	42.2	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF00641 zf-RanBP	8.3e-09	45.9	Zn-finger in Ran binding protein and others

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254108

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336712	0.998	Transportin-1
2	9606.ENSP00000425979	0.997	Ribonuclease 3
3	9606.ENSP00000362649	0.988	Histone deacetylase 1
4	9606.ENSP00000240185	0.985	TAR DNA-binding protein 43
5	9606.ENSP00000349748	0.963	Splicing factor, proline- and glutamine-rich
6	9606.ENSP00000337632	0.956	SAP domain-containing ribonucleoprotein
7	9606.ENSP00000406162	0.951	Protein arginine N-methyltransferase 1
8	9606.ENSP00000482753	0.944	Guanine nucleotide exchange C9orf72
9	9606.ENSP00000363745	0.939	Heterogeneous nuclear ribonucleoprotein R
10	9606.ENSP00000225792	0.938	Probable ATP-dependent RNA helicase DDX5
11	9606.ENSP00000380033	0.937	Probable ATP-dependent RNA helicase DDX17
12	9606.ENSP00000366843	0.936	Ataxin-2
13	9606.ENSP00000404121	0.935	Interleukin enhancer-binding factor 3
14	9606.ENSP00000420195	0.927	Serine/arginine-rich splicing factor 10
15	9606.ENSP00000351777	0.925	Transitional endoplasmic reticulum ATPase
16	9606.ENSP00000276079	0.922	Non-POU domain-containing octamer-binding protein
17	9606.ENSP00000354346	0.921	Matrin-3
18	9606.ENSP00000376276	0.905	Serine/arginine-rich splicing factor 2
19	9606.ENSP00000283179	0.900	Heterogeneous nuclear ribonucleoprotein U
20	9606.ENSP00000358635	0.900	Heterogeneous nuclear ribonucleoprotein Q

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0003729	0.557	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.997	cellular metabolic process
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.990	nitrogen compound metabolic process
GO:0043170	0.988	macromolecule metabolic process
GO:0034641	0.954	cellular nitrogen compound metabolic process
GO:1901360	0.950	organic cyclic compound metabolic process
GO:0050789	0.949	regulation of biological process
GO:0006725	0.949	cellular aromatic compound metabolic process
GO:0046483	0.947	heterocycle metabolic process
GO:0010467	0.941	gene expression
GO:0016070	0.939	RNA metabolic process
GO:0008380	0.934	RNA splicing
GO:0050794	0.925	regulation of cellular process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0080090	0.699	regulation of primary metabolic process
GO:0051171	0.699	regulation of nitrogen compound metabolic process
GO:0031323	0.697	regulation of cellular metabolic process
GO:0048518	0.640	positive regulation of biological process
GO:0048519	0.624	negative regulation of biological process
GO:0010468	0.611	regulation of gene expression
GO:0019219	0.594	regulation of nucleobase-containing compound metabolic process
GO:0071840	0.589	cellular component organization or biogenesis
GO:0016043	0.561	cellular component organization
GO:0051252	0.545	regulation of RNA metabolic process
GO:0048523	0.535	negative regulation of cellular process
GO:0048522	0.530	positive regulation of cellular process
GO:0010605	0.526	negative regulation of macromolecule metabolic process
GO:0010604	0.495	positive regulation of macromolecule metabolic process
GO:0050896	0.477	response to stimulus
GO:0051172	0.453	negative regulation of nitrogen compound metabolic process
GO:0031324	0.439	negative regulation of cellular metabolic process
GO:0051253	0.412	negative regulation of RNA metabolic process
GO:0031325	0.411	positive regulation of cellular metabolic process
GO:0051173	0.409	positive regulation of nitrogen compound metabolic process
GO:0031326	0.376	regulation of cellular biosynthetic process
GO:0010556	0.374	regulation of macromolecule biosynthetic process
GO:0044085	0.309	cellular component biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.978	cytoplasm
GO:0043228	0.950	non-membrane-bounded organelle
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0032991	0.921	protein-containing complex
GO:0005829	0.521	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]